PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_08639
Common NameKK1_008891
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CO-like
Protein Properties Length: 393aa    MW: 44226.4 Da    PI: 5.0946
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_08639genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.27e-081661342
       zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                   +r C+ + + +++++C  ++ +lC+ C +  H+       H++v+l
  C.cajan_08639 16 ARACESCLKVRARWYCAADDAFLCRGCDTMVHSAnqlasrHERVKL 61
                   578******99*********************66889999998875 PP

2CCT67.14.9e-23336379144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk++
  C.cajan_08639 336 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT 379
                    9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.7E-81461IPR000315B-box-type zinc finger
PROSITE profilePS5011910.3521461IPR000315B-box-type zinc finger
PfamPF006436.1E-61661IPR000315B-box-type zinc finger
CDDcd000213.71E-71761No hitNo description
PfamPF062038.8E-18336378IPR010402CCT domain
PROSITE profilePS5101715.993336378IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MSNEMKEASA LGARTARACE SCLKVRARWY CAADDAFLCR GCDTMVHSAN QLASRHERVK  60
LQTASSKVNY SVTPHDSNKV AWHSGFTRKA RTPRHKHSSV QQQLQHEQEE VFFNNTISSL  120
PLVPELGSEE PLLNDESEEQ LLCRVPVFDA EEAFDLEFLP SDMDLADFAA DVENLLGNGA  180
GEDSCEHMKG SELLLKEEEG DEMDACVNGL IGAKDAMVKV KDEEELDGDD TACHILDMDS  240
EAFNWNINAE SESHAQEQEE EVSKVGINNK KDIFLRLNYE EVITAWASQG SPWTTGTPPK  300
FNSDDCWPDV LGSSGVDVQF RYGELRSLMG HRDGGREARV SRYREKRRTR LFAKKIRYEV  360
RKLNAEKRPR MKGRFVKRTS FVGATALPPL TSK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1346362RRTRLFAKKIRYEVRKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_08639
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0689051e-172HM068905.1 Glycine max CONSTANS-like zinc finger protein (COL23) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029126673.10.0zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A151TRN50.0A0A151TRN5_CAJCA; Zinc finger protein CONSTANS-LIKE 16
STRINGGLYMA07G10161.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.16e-89B-box type zinc finger protein with CCT domain