PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_07731
Common NameKK1_007944
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 230aa    MW: 25961.7 Da    PI: 8.8407
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_07731genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.63.2e-23250149
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   k+ +n+sn qvtfskRr g++KKA+EL++LC+++va+i+fs+++k++ +
  C.cajan_07731  2 KKMSNESNLQVTFSKRRSGVFKKASELCTLCGTDVALIMFSPSDKVFSF 50
                   5689*****************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd002654.63E-31163No hitNo description
PROSITE profilePS5006621.488154IPR002100Transcription factor, MADS-box
SMARTSM004324.4E-25153IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.53E-24169IPR002100Transcription factor, MADS-box
PfamPF003191.5E-23450IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-91631IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-93152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MKKMSNESNL QVTFSKRRSG VFKKASELCT LCGTDVALIM FSPSDKVFSF GHPSVDAVIE  60
RYLARAPLPN SSTMQFIEAH RTANVNELNT QLTQINIQLD AERKRAEELA RLKKVVQAQM  120
WWASPIEEMS TAQLEQFKLV LEELKKHVAC LVDRVMLQSV ANPAHQFFPG ASSSPNLVHQ  180
PQPPQEFPQQ FIQPPMLQNY MFSNRTMTHQ YHHGFNNTGS GGYGSIGGFF
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_07731
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020233169.11e-174agamous-like MADS-box protein AGL62
SwissprotQ9FKK24e-54AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0A151U7J81e-172A0A151U7J8_CAJCA; Agamous-like MADS-box protein AGL62
STRINGGLYMA10G40080.11e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-56AGAMOUS-like 62
Publications ? help Back to Top
  1. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]
  2. Figueiredo DD,Batista RA,Roszak PJ,Köhler C
    Auxin production couples endosperm development to fertilization.
    Nat Plants, 2015. 1: p. 15184
    [PMID:27251719]
  3. Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C
    Auxin production in the endosperm drives seed coat development in Arabidopsis.
    Elife, 2017.
    [PMID:27848912]
  4. Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
    Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal.
    Plant Signal Behav, 2017. 12(8): p. e1339000
    [PMID:28613109]
  5. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]