PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_07729
Common NameKK1_007942
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 176aa    MW: 20490 Da    PI: 9.8311
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_07729genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.43.3e-222470450
                   -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
         SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                   +  sn+qvtfskRr+g++KKA+EL++LC++ +a+i+fs+ +kl+ +s
  C.cajan_07729 24 DKASNKQVTFSKRRTGLFKKASELCILCNVYAAIIVFSPADKLFIFS 70
                   6789***************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-301372IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.5861373IPR002100Transcription factor, MADS-box
CDDcd002651.18E-311489No hitNo description
SuperFamilySSF554551.7E-261487IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-191535IPR002100Transcription factor, MADS-box
PfamPF003194.4E-212569IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-193550IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-195071IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MDMLNQKKKK INTGRKKIEI KKLDKASNKQ VTFSKRRTGL FKKASELCIL CNVYAAIIVF  60
SPADKLFIFS HPDIDTILTR YVKGTAESEP TKSRGKTVSY EEHNMQYEEA KKKLEMEKKI  120
LEETEMLAKT CNGNLWWNQP VDQILDDQLE PFMVAVYELR KKLAERATQL MMFGMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A2e-1914101286MEF2 CHIMERA
6bz1_B2e-1914101286MEF2 CHIMERA
6bz1_C2e-1914101286MEF2 CHIMERA
6bz1_D2e-1914101286MEF2 CHIMERA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_07729
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020233147.11e-129agamous-like MADS-box protein AGL61
TrEMBLA0A151U7E11e-128A0A151U7E1_CAJCA; Agamous-like MADS-box protein AGL62
STRINGGLYMA20G27361.18e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.15e-26AGAMOUS-like 61