PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_07398
Common NameKK1_007602, KK1_007626
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 83aa    MW: 9547.21 Da    PI: 10.3246
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_07398genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.22.5e-29959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   k+ie+ + rqvtfskRr+g+ KKA+ELSvLCda+vavi+fs++g+lye+ss
  C.cajan_07398  9 KKIEDATSRQVTFSKRRTGLVKKANELSVLCDAQVAVIVFSQNGRLYEFSS 59
                   68***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.3E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.796161IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-29323IPR002100Transcription factor, MADS-box
CDDcd002652.16E-34360No hitNo description
SuperFamilySSF554556.8E-29371IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.5E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MVRGKVQMKK IEDATSRQVT FSKRRTGLVK KANELSVLCD AQVAVIVFSQ NGRLYEFSSS  60
EYVFLHFSKF MFCLRISTSI DML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-17183185Myocyte-specific enhancer factor 2B
1tqe_Q1e-17183185Myocyte-specific enhancer factor 2B
1tqe_R1e-17183185Myocyte-specific enhancer factor 2B
1tqe_S1e-17183185Myocyte-specific enhancer factor 2B
6c9l_A1e-17183185Myocyte-specific enhancer factor 2B
6c9l_B1e-17183185Myocyte-specific enhancer factor 2B
6c9l_C1e-17183185Myocyte-specific enhancer factor 2B
6c9l_D1e-17183185Myocyte-specific enhancer factor 2B
6c9l_E1e-17183185Myocyte-specific enhancer factor 2B
6c9l_F1e-17183185Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_07398
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020232325.19e-55MADS-box protein AGL42
SwissprotQ9FIS14e-29AGL42_ARATH; MADS-box protein AGL42
TrEMBLA0A151U6S22e-53A0A151U6S2_CAJCA; Agamous-like MADS-box protein AGL14
STRINGevm.model.supercontig_4.2043e-31(Carica papaya)
STRINGXP_007143357.13e-31(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.41e-31AGAMOUS-like 42