PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_07388
Common NameKK1_007591
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 747aa    MW: 81960.5 Da    PI: 6.0512
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_07388genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.57.1e-2154109156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    +++ +++t++q++eLe++F+++++p++++r +L+k+l+L+ +qVk+WFqNrR+++k
  C.cajan_07388  54 KKRYHRHTPHQIQELEAFFKECPHPDEKQRLDLSKRLSLENKQVKFWFQNRRTQMK 109
                    688999***********************************************999 PP

2START1771.2e-552624852206
                    HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
          START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                    la++a++el+k+ +ae+p+W ks     +  n +e+ + f++  +     + +ea r++g+v+ ++  lve+l+d + +W e+++    +a  l+v
  C.cajan_07388 262 LALAAMEELLKMTQAESPLWIKSLdgekQVFNHEEYARLFSPCIGpkptgYVTEATRETGIVIINSLALVETLMDAN-RWAEMFPsmiaRAINLDV 356
                    6899********************7766666889999999998889*******************************.*******99999999*** PP

                    ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE-- CS
          START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlk 173
                    is+g      galq+m ae q+lsplvp R + f+R+++q+ +g+w++vdvS+d   +  + ++++ +++lpSg+++++++ng+skvtw+eh++++
  C.cajan_07388 357 ISNGmggtrnGALQVMHAEVQLLSPLVPvRQVRFLRFCKQHAEGVWAVVDVSIDIGHDAANAQPFMSCRRLPSGCIVQDMPNGYSKVTWLEHWEYD 452
                    *******************************************************9999999********************************** PP

                    SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
          START 174 grlphwllrslvksglaegaktwvatlqrqcek 206
                    ++++h+l+r+l++ g+ +ga +w atlqrqce+
  C.cajan_07388 453 ESVVHQLYRPLLSCGVGFGAHRWIATLQRQCEC 485
                    *******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.43E-2039111IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-2140105IPR009057Homeodomain-like
PROSITE profilePS5007117.4151111IPR001356Homeobox domain
SMARTSM003891.6E-1852115IPR001356Homeobox domain
CDDcd000861.42E-1853111No hitNo description
PfamPF000461.7E-1854109IPR001356Homeobox domain
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PROSITE profilePS5084841.119252488IPR002913START domain
SuperFamilySSF559613.39E-31254485No hitNo description
CDDcd088751.04E-118256484No hitNo description
SMARTSM002345.0E-35261485IPR002913START domain
PfamPF018522.8E-46262485IPR002913START domain
SuperFamilySSF559619.12E-21513741No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MEGPSEMGLI GENFDAGLMG RMRDDEYESR SGSDNFEGVS GDDQDGGDDQ PQRKKRYHRH  60
TPHQIQELEA FFKECPHPDE KQRLDLSKRL SLENKQVKFW FQNRRTQMKT QLERHENIML  120
RQENEKLRAE NSLMKDAMSN PVCNNCGGPA IPGQISFEEH QIRIENARLK DELNRICALA  180
NKFLGKPISS LTSPMALPTS NSGLELGIGR NGIGGSTTLG TPLPMGLDLG DLGTQPAMPG  240
IRPPLGLMGN EVQLERSMLI DLALAAMEEL LKMTQAESPL WIKSLDGEKQ VFNHEEYARL  300
FSPCIGPKPT GYVTEATRET GIVIINSLAL VETLMDANRW AEMFPSMIAR AINLDVISNG  360
MGGTRNGALQ VMHAEVQLLS PLVPVRQVRF LRFCKQHAEG VWAVVDVSID IGHDAANAQP  420
FMSCRRLPSG CIVQDMPNGY SKVTWLEHWE YDESVVHQLY RPLLSCGVGF GAHRWIATLQ  480
RQCECLAILM SSSISSDDHT ALSQAGRRSM LKLAQRMTSN FCSGVCASSA RKWDSLHIGT  540
LGDDMKVMTR KNVDDPGEPP GIVLSAATSV WVPVTRQRLF DFLRDERLRS EWDILSNGGP  600
MQEMVHIAKG QGHGNCVSLL RANAVNANDS SMLILQETWM DASCSVVVYA PVDVQSLNVV  660
MSGGDSAYVA LLPSGFAILP DGHSSNSCNG TMAKGGGDNS GGSLLTVGFQ ILVNSLPTAK  720
LTVESVDTVN NLISCTIQKI KAALRVA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_07388
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020239648.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_020239654.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A151U6K60.0A0A151U6K6_CAJCA; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
STRINGGLYMA10G38280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]