PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_06835
Common NameKK1_007027
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YC
Protein Properties Length: 230aa    MW: 25481.6 Da    PI: 6.7987
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_06835genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC444.7e-1483119235
          NF-YC   2 lksfwekq...iekatdfknhelPlarikkilkaded 35 
                    l++fw++q   iek+tdfknh+lPlarikki+kaded
  C.cajan_06835  83 LQAFWANQyqeIEKVTDFKNHSLPLARIKKIMKADED 119
                    89*****99999************************9 PP

2NF-YC42.41.6e-1311815267101
          NF-YC  67 eenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                    e+nkrrtl+k+diaaa+trtdifdflvdivpr++l
  C.cajan_06835 118 EDNKRRTLQKNDIAAAITRTDIFDFLVDIVPREDL 152
                    589*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471137.18E-1466143IPR009072Histone-fold
Gene3DG3DSA:1.10.20.107.5E-896119IPR009072Histone-fold
Gene3DG3DSA:1.10.20.109.5E-10120149IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MDHQGHGHGQ NPSMGVVGSG PQLTFGSNPY QTSHLTGSPG MVVASPGTIQ STGQPPATQL  60
GQQYQLANQH IHQQQQQQLQ QRLQAFWANQ YQEIEKVTDF KNHSLPLARI KKIMKADEDN  120
KRRTLQKNDI AAAITRTDIF DFLVDIVPRE DLKDEVLASM PRGTVPVTGP AEALPYCYMP  180
PQHAQQVGTA GVIMGNKPVM DPYAQQSHPY NMAPQMWPQP PDQQQSSPDQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121127RRTLQKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-108AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007144748.11e-130hypothetical protein PHAVU_007G181400g
SwissprotQ8L4B27e-49NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
TrEMBLA0A151U4V11e-170A0A151U4V1_CAJCA; Nuclear transcription factor Y subunit C-9
STRINGGLYMA20G37620.11e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08970.45e-48nuclear factor Y, subunit C9