PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_05893
Common NameKK1_006042
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family LBD
Protein Properties Length: 161aa    MW: 18190.5 Da    PI: 8.2757
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_05893genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.71.1e-3941031100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk +rr+C++dC++apyfpa++p++fa vh+++G snv k+l+++p+  re+a+++l+yeA++r+r+PvyG+vgvi+kl+q++++++  l++
  C.cajan_05893   4 RCAACKNQRRRCPSDCIFAPYFPANDPQRFASVHRIYGGSNVGKMLQQIPPYLREQAANTLYYEAQCRIRNPVYGCVGVISKLSQEISNTEIALSQ 99 
                    6*****************************************************************************************999998 PP

         DUF260  97 lkee 100
                    ++++
  C.cajan_05893 100 IETQ 103
                    8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5573104IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-394100IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MSGRCAACKN QRRRCPSDCI FAPYFPANDP QRFASVHRIY GGSNVGKMLQ QIPPYLREQA  60
ANTLYYEAQC RIRNPVYGCV GVISKLSQEI SNTEIALSQI ETQIDCHKNQ VQQAKAESKF  120
NVLSTIEAES NFDVLQGQSS SATEFHMPSQ LKWFNKNSDF Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-34510412111LOB family transfactor Ramosa2.1
5ly0_B4e-34510412111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_05893
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150363e-54AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020229762.11e-119LOB domain-containing protein 24
SwissprotP594676e-41LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594686e-41LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A151U2841e-117A0A151U284_CAJCA; LOB domain-containing protein 23
STRINGXP_007142295.14e-77(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.12e-43LOB domain-containing protein 23