PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_05563
Common NameKK1_005703
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family LBD
Protein Properties Length: 155aa    MW: 17304.7 Da    PI: 5.9774
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_05563genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.56.3e-4561051100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +Ca+Ck+lrr+C+kdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +la+
  C.cajan_05563   6 PCASCKLLRRRCTKDCTFAPYFPSDDPQKFAIVHKVFGASNVSKMLQELPVHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSELQMQLAV 101
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  C.cajan_05563 102 AQAE 105
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.5115106IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MGGSSPCASC KLLRRRCTKD CTFAPYFPSD DPQKFAIVHK VFGASNVSKM LQELPVHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVSELQMQLA VAQAEIFCIQ MEHESVMPTS  120
EIDLDHKSYL FQNDFTQFLG FGTSSNVIHN SLEQF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358821e-125AC235882.2 Glycine max clone GM_WBc0011M13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014622101.14e-99PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW33e-76LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A151U1B81e-114A0A151U1B8_CAJCA; LOB domain-containing protein 12
STRINGGLYMA14G06140.11e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-77LBD family protein