PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_05316
Common NameKK1_005448
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YC
Protein Properties Length: 206aa    MW: 23443.3 Da    PI: 7.7122
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_05316genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC32.91.4e-1066103135
          NF-YC   1 qlksfwekq...iekatdfknhelPlarikkilkaded 35 
                    ql++fw+kq   i++at+fk  ++Pl+ri+ki+kaded
  C.cajan_05316  66 QLNNFWAKQcqeIGEATNFKTPNMPLSRIRKIMKADED 103
                    799*****9888899*********************98 PP

2NF-YC33.49.7e-1110313667100
          NF-YC  67 eenkrrtlkksdiaaavtrtdifdflvdivprde 100
                    +enk++tl+ksdia+a+t+ d+fdflvdi prd+
  C.cajan_05316 103 DENKKKTLQKSDIASAITKNDMFDFLVDIFPRDD 136
                    699*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471139.08E-1166128IPR009072Histone-fold
Gene3DG3DSA:1.10.20.104.4E-482103IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.5E-8104134IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MDQNQQGQGV NHPTQAARGK NKYEFNPMVG PSNPPTQIVG PSNLSPHPRD APEYTNQLQQ  60
DVLQQQLNNF WAKQCQEIGE ATNFKTPNMP LSRIRKIMKA DEDENKKKTL QKSDIASAIT  120
KNDMFDFLVD IFPRDDKLEH ADIPRRGTAP IENVPYYYYM SPHQYVARPP HGAPGMVMGR  180
PIPDQNQNGL QTRPFFPTPM RPTSDE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014634043.11e-52PREDICTED: nuclear transcription factor Y subunit C-2-like
SwissprotQ9SMP03e-25NFYC1_ARATH; Nuclear transcription factor Y subunit C-1
TrEMBLA0A151U0P01e-153A0A151U0P0_CAJCA; Nuclear transcription factor Y subunit C-1
STRINGGLYMA08G15700.12e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.12e-26nuclear factor Y, subunit C1