PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_04121
Common NameKK1_004221
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 202aa    MW: 23661.5 Da    PI: 4.7079
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_04121genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM105.66.4e-3381261128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGf F+Ptdeelv ++L  k++  +++  ++i+e++  +++Pw+L+ k+  + +++yfFsk +        +nr+t++gyWk+ g ++++ls+ 
  C.cajan_04121   8 LPPGFFFSPTDEELVLHFLFCKASLIPCHP-NIIPELHSSHLDPWELNGKALFSGNQYYFFSKVN--------ENRTTENGYWKEIGMTEPILSTV 94 
                    79*************************999.89**************96666788999***9875........5899******************9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    +++vg+kk Lvf+ g+ap+ ++t+Wvm+ey++
  C.cajan_04121  95 DKKVGMKKYLVFHIGEAPQDTETNWVMQEYHI 126
                    ******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-425160IPR003441NAC domain
PROSITE profilePS5100538.8978160IPR003441NAC domain
PfamPF023655.4E-219126IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MEDGSINLPP GFFFSPTDEE LVLHFLFCKA SLIPCHPNII PELHSSHLDP WELNGKALFS  60
GNQYYFFSKV NENRTTENGY WKEIGMTEPI LSTVDKKVGM KKYLVFHIGE APQDTETNWV  120
MQEYHICSSG FDMASYRSAR RRRKHDQSWS KWVLCRVYEK RRCEEGVKCY SDDEDENGSE  180
LSWLDEFYLR LDDDLEEIGM SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A7e-35616518173NAC domain-containing protein 19
3swm_B7e-35616518173NAC domain-containing protein 19
3swm_C7e-35616518173NAC domain-containing protein 19
3swm_D7e-35616518173NAC domain-containing protein 19
3swp_A7e-35616518173NAC domain-containing protein 19
3swp_B7e-35616518173NAC domain-containing protein 19
3swp_C7e-35616518173NAC domain-containing protein 19
3swp_D7e-35616518173NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_04121
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312090.0KT031209.1 Glycine max clone HN_CCL_4 NAC transcription factor (Glyma04g38990.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020224898.11e-152NAC domain-containing protein 104
SwissprotQ8GWK64e-59NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A151ST191e-150A0A151ST19_CAJCA; NAC domain-containing protein 68
STRINGGLYMA04G38990.11e-118(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.12e-61xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]