PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_03622
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CO-like
Protein Properties Length: 698aa    MW: 78690.9 Da    PI: 7.4669
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_03622genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.58.4e-062051435
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHk 35
                   + C+ ++   + lfC+ ++ +lC  C +++H 
  C.cajan_03622 20 KPCDSCKLASAALFCRPDSAFLCIACDTKIHC 51
                   68******99********************95 PP

2zf-B_box186e-06351391438
       zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38 
                    + C+ ++   + lfC  ++ +lC  C +++H        H+
  C.cajan_03622 351 KPCDSCKLASAALFCPPDSAFLCIACDTKIHCAnklasrHE 391
                    68******99*********************5545666665 PP

3zf-B_box253.9e-08393437341
       zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                     ++C+ +e+ ++   C+ +   lC +C + +H+       H++ p
  C.cajan_03622 393 VWMCEVCEQAPAAVTCKADAAALCVTCDSDIHSAnplsrrHDRLP 437
                    689*****************************6678888888776 PP

4CCT68.61.7e-23625668144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  C.cajan_03622 625 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 668
                    9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.9541764IPR000315B-box-type zinc finger
SMARTSM003366.2E-71764IPR000315B-box-type zinc finger
CDDcd000212.18E-42150No hitNo description
PROSITE profilePS501199.655348395IPR000315B-box-type zinc finger
SMARTSM003366.8E-10348395IPR000315B-box-type zinc finger
CDDcd000211.28E-5352395No hitNo description
PROSITE profilePS5011910.637391438IPR000315B-box-type zinc finger
PfamPF006436.7E-6393437IPR000315B-box-type zinc finger
CDDcd000215.86E-7394438No hitNo description
SMARTSM003365.4E-9396438IPR000315B-box-type zinc finger
PfamPF062031.3E-17625667IPR010402CCT domain
PROSITE profilePS5101716.787625667IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MGIERGGLKG LRSGWTVPPK PCDSCKLASA ALFCRPDSAF LCIACDTKIH CANKLASRHX  60
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  120
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  180
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  240
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  300
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXGPVPP KPCDSCKLAS  360
AALFCPPDSA FLCIACDTKI HCANKLASRH ERVWMCEVCE QAPAAVTCKA DAAALCVTCD  420
SDIHSANPLS RRHDRLPVQP FFDSAESIVK ASAAASFGFL VPTDDAAAFA PDDADAAAWL  480
IPNPNFGSKL MDTPDIKSKE IFFSEMDPFL DFDYSNSFQN NNSTTNDSVV PVQSKPSLPP  540
PLMNNHHQSE NCFDIDFCRS KLSSFNYPSQ SLSQSVSSSS LDVGVVPDGN TVSEISYSFG  600
RNSSDSSGIA VSGGSAATQL CGMDREARVL RYREKRKNRK FEKTIRYASR KAYAETRPRI  660
KGRFAKRTEI DSDVDRLYSP ATAAALMLDT PYGVVPSF
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_03622
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029129161.10.0zinc finger protein CONSTANS-LIKE 5
SwissprotQ9FHH81e-113COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A151SRR40.0A0A151SRR4_CAJCA; Zinc finger protein CONSTANS-LIKE 5
STRINGXP_007154800.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.13e-95CONSTANS-like 5
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]