PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_03143
Common NameKK1_003215
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 372aa    MW: 40932.4 Da    PI: 5.2464
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_03143genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF30.64.2e-101254345
                   --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
         SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                   ie+   r++ + kRr+ +lKK e L +LC+++ + ii ++ + 
  C.cajan_03143 12 IEDFVTRKTCYNKRRASLLKKMEDLTTLCAVDSCAIIDGPGDD 54
                   899999******************************9988665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006611.563248IPR002100Transcription factor, MADS-box
SMARTSM004323.2E-7261IPR002100Transcription factor, MADS-box
CDDcd002663.26E-17385No hitNo description
SuperFamilySSF554551.31E-15494IPR002100Transcription factor, MADS-box
PfamPF003194.5E-101252IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MPRRKKAAQN LIEDFVTRKT CYNKRRASLL KKMEDLTTLC AVDSCAIIDG PGDDVPTVWP  60
SHDKARELLD KFENAPLTDR WRKNVTPQIY VEQKNKKIEN QLAMLKEKND GKDMSIFMHK  120
IHHDGKSLSD FDASDISRLL CYVEGKLKGV REKTGHTKHH ELSPNPPTPP VSCPLKNDIG  180
SQPNTDEPVF EQSTLDLKKE DATMNNGVDN NIGSNNNMGL PPPPHTHLGD VDMVLHQDQV  240
NFEGFNHGDV DMVLPPGNFG GLIDESGSSG VLPQGNFTGL NGNSDSGFLY GSYFGEIGGS  300
DLWPSYGNFG GTIGQHDENQ GGSINNIGLW GHQSNFGANN DAVAVGRSSN YPNFVEGSDI  360
EWPTFEGFFS SK
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_03143
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020225349.10.0agamous-like MADS-box protein AGL36
TrEMBLA0A151SQ590.0A0A151SQ59_CAJCA; MADS-box transcription factor PHERES 2
STRINGXP_007162987.11e-127(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15602811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.11e-22AGAMOUS-like 38