PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_02912
Common NameKK1_002981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family bZIP
Protein Properties Length: 163aa    MW: 18642 Da    PI: 10.0721
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_02912genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.82.6e-1456114462
                    XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                    +++ +r+ +NRe+ArrsR RKk++ie L+  v+ L++ N++L +++  l +  ++  ++
  C.cajan_02912  56 DRKKKRMFSNRESARRSRMRKKQQIEVLQYHVDHLQTLNHQLSQKIIYLLECNQQINQH 114
                    7899***************************************9986665555555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.1E-1353117IPR004827Basic-leucine zipper domain
PfamPF077164.2E-1255102IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.16255118IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.0E-1157108No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-1357113No hitNo description
CDDcd147021.72E-1258106No hitNo description
PROSITE patternPS0003606075IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MDPPHSLHHV PFLYSQLHLP SINNNPIQLP LHKSSPNTSS NSNNNNSDEA KALLDDRKKK  60
RMFSNRESAR RSRMRKKQQI EVLQYHVDHL QTLNHQLSQK IIYLLECNQQ INQHNAQLKE  120
KVSTLQVALS ELLVPAGSAE QHHHIPNGFL DESSTRPIAS SRA
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_02912
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020228490.11e-115basic leucine zipper 43
TrEMBLA0A151SPH41e-114A0A151SPH4_CAJCA; Transcriptional activator TAF-1
STRINGXP_007155196.12e-83(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.11e-27basic leucine-zipper 70