PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_02899
Common NameKK1_002968
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 89aa    MW: 9971.43 Da    PI: 10.456
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_02899genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF103.11e-32959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye+ss
  C.cajan_02899  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSS 59
                   79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.782161IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-31263IPR002100Transcription factor, MADS-box
CDDcd002652.52E-40265No hitNo description
PRINTSPR004041.1E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.8E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFSST  60
SRYNQSGPED ANVGASSLSM HGFASGWML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-21161161MEF2C
5f28_B2e-21161161MEF2C
5f28_C2e-21161161MEF2C
5f28_D2e-21161161MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor active in inflorescence development and floral organogenesis.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_02899
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0932648e-87BT093264.1 Soybean clone JCVI-FLGm-14C7 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022561723.13e-36agamous-like MADS-box protein AGL9 homolog isoform X3
RefseqXP_022850778.19e-37MADS-box protein EJ2-like
SwissprotO040673e-36AGL9_SINAL; Agamous-like MADS-box protein AGL9 homolog
TrEMBLA0A151SPN86e-59A0A151SPN8_CAJCA; Agamous-like MADS-box protein AGL9 isogeny
STRINGcassava4.1_030388m4e-37(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.32e-37MIKC_MADS family protein
Publications ? help Back to Top
  1. Bonhomme F,Sommer H,Bernier G,Jacqmard A
    Characterization of SaMADS D from Sinapis alba suggests a dual function of the gene: in inflorescence development and floral organogenesis.
    Plant Mol. Biol., 1997. 34(4): p. 573-82
    [PMID:9247539]