PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_02898
Common NameKK1_002967
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family SBP
Protein Properties Length: 440aa    MW: 48374.8 Da    PI: 7.681
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_02898genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.51.6e-42169244277
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                    Cqv gC++dls++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  C.cajan_02898 169 CQVYGCNKDLSSCKDYHKRHKVCEVHSKTATVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 244
                    **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-33163230IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.573166243IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-39167247IPR004333Transcription factor, SBP-box
PfamPF031101.5E-31169242IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MEPWSYVPEE KECVSNEGLS SPNTLGRNKN SFLGWELKTP CGFPNDMLGL GQHSIENQGF  60
EELGLPEMLG KQLSDDLIGS VQSRKVDGRQ QHSDRITSTV VDTPSGFSQR GYSNSKLSYS  120
NSLIDLKLGR FADHGDAPDL GFSKVLSSES STPPKRVRAS GLQSQTAYCQ VYGCNKDLSS  180
CKDYHKRHKV CEVHSKTATV IVNGIEQRFC QQCSRFHLLA EFDDGKRSCR KRLAGHNERR  240
RKPQMGIHSG KSGRLLQPCG DSRFQGNMLT SSFIRPEMLP SGIMHSDKYV GNEDFNVFDT  300
TSTVQGLSGI SDSCALSLLS SQSQNSSSQS SGIPLAHSLV IPSSHNHHYN ISQVSGKIGI  360
SSQTSSSRVS NSFPSELNHA DGNGIFQGSD FVNVKDRLSC EDGATINLLQ LSSQLQRVEH  420
DRQSLQVKQE NDSCCTLRIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-291692421184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_02898
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020226700.10.0squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A151SPF20.0A0A151SPF2_CAJCA; Squamosa promoter-binding-like protein 6
STRINGGLYMA0005S50.21e-174(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.18e-56SBP family protein