PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_02643
Common NameKK1_002708
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family TALE
Protein Properties Length: 283aa    MW: 32234.5 Da    PI: 6.8876
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_02643genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.68.7e-082322652154
                    HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
       Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                    k +yp+++++++L +++gL+ +q+ +WF N+R +
  C.cajan_02643 232 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 265
                    469*****************************87 PP

2ELK25.62.9e-09186207122
            ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                    ELK +L++++++++ ++++E++
  C.cajan_02643 186 ELKIELKQGFKSRIEDVREEIL 207
                    9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.7E-192064IPR005540KNOX1
PfamPF037904.2E-172263IPR005540KNOX1
SMARTSM012562.2E-2475130IPR005541KNOX2
PfamPF037913.2E-1778129IPR005541KNOX2
PROSITE profilePS512139.132186206IPR005539ELK domain
PROSITE profilePS5007111.645206269IPR001356Homeobox domain
SMARTSM003893.4E-11208273IPR001356Homeobox domain
SuperFamilySSF466892.91E-16208273IPR009057Homeodomain-like
CDDcd000865.65E-12209270No hitNo description
Gene3DG3DSA:1.10.10.601.4E-25213271IPR009057Homeodomain-like
PfamPF059201.0E-17226265IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MQEAAALGMM GGELSDHHHR QVKAEIATHP LYDQLLAAHV SCLRVATPID QLPLIDAQLS  60
QSHHLLRSYA SLHSHSLSPH DRQQLDNFMT QYLIVLCSFK EQLQQHVRVH AVEAVMACRD  120
IESTFQALTG VSLGEGTGAT MSDDEDDFQM DGSLDQCSAD GQDMMGFGPL LPTESERSLM  180
ERVRQELKIE LKQGFKSRIE DVREEILRKR RAGKLPGDTT SVLKAWWQQH AKWPYPTEDD  240
KAKLVEETGL QLKQINNWFI NQRKRNWHSN SQSVTSLKSK RKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A5e-13209265864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1262282RKRNWHSNSQSVTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtPossible developmental regulator.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_02643
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By wounding; up to 7-fold increase.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939000.0BT093900.1 Soybean clone JCVI-FLGm-17N4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020226705.10.0homeobox protein HD1 isoform X1
SwissprotP466061e-162HD1_BRANA; Homeobox protein HD1
TrEMBLA0A151SNR80.0A0A151SNR8_CAJCA; Homeobox protein HD1
STRINGXP_007158449.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-165KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Boivin R,Hamel F,Beauseigle D,Bellemare G
    Stage-specific transcription of the homebox gene Bnhd1 in young tissues and flowers of Brassica napus.
    Biochim. Biophys. Acta, 1994. 1219(1): p. 201-4
    [PMID:7916213]