PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_02238
Common NameKK1_002291
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family LBD
Protein Properties Length: 292aa    MW: 33299.2 Da    PI: 6.029
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_02238genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.41.6e-35101091100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCaaCk++rrkC+++C lap fpa+qpk f nvhklFG+sn++k+lk l+++++++am+s++ +A+ r + Pv+G+ + i +lq q+  +++el++
  C.cajan_02238  10 ACAACKHQRRKCTSECLLAPFFPADQPKVFLNVHKLFGVSNIVKILKILEPSQKKIAMDSIIIQANYRDKYPVHGCWEEICRLQYQIWVMEEELHA 105
                    7*********************************************************************************************99 PP

         DUF260  97 lkee 100
                    + ++
  C.cajan_02238 106 VYQQ 109
                    9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.3689110IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3410106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MTLKGGTTQA CAACKHQRRK CTSECLLAPF FPADQPKVFL NVHKLFGVSN IVKILKILEP  60
SQKKIAMDSI IIQANYRDKY PVHGCWEEIC RLQYQIWVME EELHAVYQQL EICRQQHHQG  120
PSMHDDVASQ LELGMTPRTS NALPLFNHHT PQPQPQPHTY NTVALSVSQQ QQHSYSNSNS  180
VDYNSLYLDS KDNTTNPLWV QYSYANNNSN SVGMDTQFSS QPLAIQQNVV EDYDEIHPIF  240
DSVDDRQSYI YSKEAYESSS EESLKDMRKC TDHVSENELK SAAACFSLTS VN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-2661107111LOB family transfactor Ramosa2.1
5ly0_B9e-2661107111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_02238
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-118AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020225931.10.0LOB domain-containing protein 27
TrEMBLA0A151SMQ20.0A0A151SMQ2_CAJCA; LOB domain-containing protein 27
STRINGXP_007155357.11e-165(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.14e-45LOB domain-containing protein 27