PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_01849
Common NameKK1_001897
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family G2-like
Protein Properties Length: 402aa    MW: 44174.6 Da    PI: 8.0275
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_01849genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-32196251156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  C.cajan_01849 196 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 251
                    68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.3E-17193254IPR009057Homeodomain-like
PROSITE profilePS5129413.355193253IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-28194254IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-26196251IPR006447Myb domain, plants
PfamPF002496.7E-7198249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MASPSELSLD CKPQSYSLLL KSFGDQTDQT YKLEEFLSRL EEERLKIDAF KRELPLCMQL  60
LTNAVEASRQ QLQAFKVNHG TKPILEEFIP MKHLASESSE KATNMSDKAN WMTSAQLWSQ  120
ASEGTKQQPS ITSPKEADIG FSISPKLGLD HKQRNGGGAF LPFSKERNSC HGSTLRPLAS  180
SHAQQTTTTT TQTHRKARRC WSPDLHRRFV NALQMLGGSQ VATPKQIREL MKVDGLTNDE  240
VKSHLQKYRL HTRRPSPSQT GPAAPQLVVL GGIWVPPEYA TAAAHSAAPT LYGAHPSSHA  300
PPPHYCAATP VPQEFYTAAP PQPLLPPPPP HHNALHHLHM YKAAPHGHGS LESDVPGGGE  360
RSESIEDGKS ESSSWKGESG ENDGERKRIG EESNGSDITL KF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-14196249154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14196249154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14196249154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14196249154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_01849
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020227542.10.0myb family transcription factor EFM
SwissprotQ9ZQ851e-121EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A151SLE20.0A0A151SLE2_CAJCA; Two-component response regulator ARR18
STRINGGLYMA05G08150.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-102G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]