PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_01724
Common NameKK1_001762
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 368aa    MW: 41947.8 Da    PI: 8.4553
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_01724genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.81.2e-221053245
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                   + e+ snr+vtfskR+ gilKKA+ELS+LCd+++ +++fs+tgk
  C.cajan_01724 10 KLESISNRHVTFSKRKSGILKKAKELSILCDIDIVLLMFSPTGK 53
                   57899*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.46153IPR002100Transcription factor, MADS-box
SMARTSM004328.8E-29160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-24295IPR002100Transcription factor, MADS-box
CDDcd002661.59E-25284No hitNo description
PRINTSPR004044.2E-17323IPR002100Transcription factor, MADS-box
PfamPF003196.2E-201254IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MGRVKLKIKK LESISNRHVT FSKRKSGILK KAKELSILCD IDIVLLMFSP TGKPTLLQGE  60
RSNLEEVIAK FAQLSPQERA KRKMESLEAL KKTFKKLDHD VKIQDFVGTS NQNVMIYMQE  120
MSHQVRVLQA QLTEVHQRLS YWNNLEKINH LEHLRQREDS LRKSINRVCL QKENLGKHQL  180
MSLECANQLQ EGMTLPLMMA NLQESQPLSW LLNNDNHQLM LPNEPKYLSF RDAECSTDIS  240
LPSYSGYIGN NKLEVGSSPQ VNTLGQGGGA MNELNGTTYL NVQRCDQFAY PPPPDIEEVK  300
NYPTMNNSKS NTVDYQVNSN FDLPRSLFEN GHQFWNSASG SCGIAMYNEN GYHRVSSPSL  360
LYSSCFHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-14192190MEF2 CHIMERA
6byy_B1e-14192190MEF2 CHIMERA
6byy_C1e-14192190MEF2 CHIMERA
6byy_D1e-14192190MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_01724
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352461e-127AC235246.1 Glycine max strain Williams 82 clone GM_WBb0033G13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020225647.10.0agamous-like MADS-box protein AGL65 isoform X1
SwissprotQ7X9I03e-92AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A151SL620.0A0A151SL62_CAJCA; MADS-box protein GGM13
STRINGGLYMA17G10941.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-94AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]