PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_01716
Common NameKK1_001754
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 274aa    MW: 32075.3 Da    PI: 4.9821
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_01716genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.34.2e-25117164552
         RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    +s + ls+yF++pi++AA+eL+v+lT+LK++CR +GI+RWPhRk+ sl
  C.cajan_01716 117 LSRKILSQYFYMPITQAARELNVGLTLLKKRCRVLGIRRWPHRKLMSL 164
                    78899****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.76899184IPR003035RWP-RK domain
PfamPF020421.3E-20117164IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MPFISGKGEV YPALDWAHDF PIQDYYFDAV PLMDYYPSDP LYETLSIEPT PTVQDYDFYD  60
IKKGFSVWNE VDAVLDSEKV FLFCNNEESG SGKEMMEDGK VNREREERIG SSSTRLLSRK  120
ILSQYFYMPI TQAARELNVG LTLLKKRCRV LGIRRWPHRK LMSLQTLINN IQELGKEEGK  180
ESEEKLRSAI EILEREKKLL EEMPDIELED NTKRLRQACF KANYKKRRLE GRRETQSSSF  240
SGHARTIDTT GEYSYENEEE RDIKYPLSSV NVMI
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_01716
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352464e-51AC235246.1 Glycine max strain Williams 82 clone GM_WBb0033G13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020225154.10.0protein RKD2
TrEMBLA0A151SLB70.0A0A151SLB7_CAJCA; Uncharacterized protein
STRINGGLYMA05G01030.21e-130(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-42RWP-RK domain-containing protein