PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_01380
Common NameKK1_001414
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family GRAS
Protein Properties Length: 419aa    MW: 46633 Da    PI: 5.7482
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_01380genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS276.96e-85504162373
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.......sseelaalkl..fsevs 88 
                    ++lL++cA+a++++d +laq++L+ l+++a pdgd++qRla+ f++AL ar a+  +++++ l + ++++++        ++++++ +l  f++++
  C.cajan_01380  50 EQLLIHCANAIETNDVTLAQQILWVLNNIAPPDGDSNQRLASSFLRALTARAAK--TGTCNMLVAVAAADTHnnddltmDTHKFSVIELanFVDLT 143
                    79****************************************************..44444443332222221235544333333444489***** PP

           GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnv 180
                    P+++f++ +aN a+lea+eg + +Hi+D+++++++Q p+L++a asR + pp +++T+ +++  +       ++ e+g +L +fA++ +v +ef+v
  C.cajan_01380 144 PWHRFGFTAANAAVLEATEGFSVIHIVDLSLTHCMQIPTLIDAVASRHDVPPLIKLTVADASFRDippmLDLSYDELGAKLVNFARSRNVVMEFRV 239
                    ***********************************************************9977779987788999********************9 PP

           GRAS 181 lvakrledleleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                     v+++ +d  + +L     + + aV +  +l +              +Lk +++l P+vv++v+++a+++s++++ r+ +a++y +  +d++++ l
  C.cajan_01380 240 -VSSSYQDG-FADLTSFLyDSSSAVTSTSSLRS-------------LFLKSLRGLDPTVVILVDEDANLTSNNLVCRLRSAFNYLWIPYDTVDTFL 320
                    .56666665.55553322255556665554444.............58************************************************ PP

           GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                    pr s++r+++E+  +g++i+nv+a+eg +r+er e +++W++r+++a F++v++se+ ++++k++l +++  g+ +++e++ +vl+Wk++++v++S
  C.cajan_01380 321 PRGSKQRQWYEAD-IGWKIENVIAHEGVQRVERVEPKNRWEQRMKNASFQAVAFSEDSVAEVKAMLDEHA-AGWGLKKEDEHIVLTWKGHNVVFAS 414
                    *************.********************************************************.999********************** PP

           GRAS 372 aW 373
                    aW
  C.cajan_01380 415 AW 416
                    ** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.5223398IPR005202Transcription factor GRAS
PfamPF035142.1E-8250416IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MTQFTPSFHQ IAPIPNPTMN KNQIPRTRPW PAGFPTSKAL TNFGDANCME QLLIHCANAI  60
ETNDVTLAQQ ILWVLNNIAP PDGDSNQRLA SSFLRALTAR AAKTGTCNML VAVAAADTHN  120
NDDLTMDTHK FSVIELANFV DLTPWHRFGF TAANAAVLEA TEGFSVIHIV DLSLTHCMQI  180
PTLIDAVASR HDVPPLIKLT VADASFRDIP PMLDLSYDEL GAKLVNFARS RNVVMEFRVV  240
SSSYQDGFAD LTSFLYDSSS AVTSTSSLRS LFLKSLRGLD PTVVILVDED ANLTSNNLVC  300
RLRSAFNYLW IPYDTVDTFL PRGSKQRQWY EADIGWKIEN VIAHEGVQRV ERVEPKNRWE  360
QRMKNASFQA VAFSEDSVAE VKAMLDEHAA GWGLKKEDEH IVLTWKGHNV VFASAWLPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-503141866474Protein SHORT-ROOT
5b3h_B7e-513141812420Protein SHORT-ROOT
5b3h_E7e-513141812420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_01380
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020228765.10.0scarecrow-like protein 32
SwissprotQ9SN221e-163SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A151SK840.0A0A151SK84_CAJCA; Scarecrow-like protein 32
STRINGXP_007155843.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-156GRAS family protein