PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_00220
Common NameKK1_000221
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 378aa    MW: 43094.2 Da    PI: 6.0104
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_00220genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.81.6e-14948140
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                   k+i++++ r +t+ +R++g++KK  E S+LC a++++i++
  C.cajan_00220  9 KPIKSERARRTTLVQRKKGLMKKLAEFSTLCRAKACLIVY 48
                   689************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.7E-11162IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-16179IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.895150IPR002100Transcription factor, MADS-box
CDDcd002662.89E-17279No hitNo description
PRINTSPR004045.0E-5323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-121150IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-52338IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-53859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MGRERITLKP IKSERARRTT LVQRKKGLMK KLAEFSTLCR AKACLIVYDD ADGDAAPVTW  60
PQDPTMVRSI IENYEHQKKV RTPKIFEIQD FFDNRKNMVE TEISKVHKKI KNIEYPTWDP  120
RFKNMGAEQL NAFISLVDAK IAACDHKINM ARNMHQSEGN FSFMPNMGHA SASSSHPSQL  180
NFMHNISQSQ AISMEQLLND NNGRVDFANT TNQVAEGTDH GINNIFRNMQ HGDVCFNYTP  240
SMVQERGTSS HVSQSNFLQN NSRDQFTVEV LKRITERNEM VNFTNEVYIP QVPQDSTYQV  300
GESLDWSNKV GDLANLVNGP IVIDDWSSQL SGDLVDWATR PNESTLQNLP VQSQNDQNEV  360
TLPALPPTLD EFQTDYYQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11425RARRTTLVQRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_00220
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029129529.10.0MADS-box transcription factor PHERES 2
TrEMBLA0A151SH330.0A0A151SH33_CAJCA; Agamous-like MADS-box protein AGL36
STRINGGLYMA19G06145.11e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.19e-19M-type_MADS family protein