PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa20g011780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family TCP
Protein Properties Length: 176aa    MW: 17733.9 Da    PI: 10.4834
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa20g011780.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1233.3e-3826102279
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesss 79 
                     a+kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as+++ +s s
  Csa20g011780.1  26 AVKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFST-ASLS 102
                     79**************************************************************999997772.2222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.2093286IPR017887Transcription factor TCP subgroup
PfamPF036342.2E-3232106IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MANNDGAVAN GVIIEQTTSN KGPLNAVKKP PSKDRHSKVD GRGRRIRMPI ICAARVFQLT  60
RELGHKSDGQ TIEWLLRQAE PSIIAATGTG TTPASFSTAS LSTSSPFTLG KRVVRAEEGE  120
SNGGGGGGVG GGLTVGHTMG TSLMSGGGGG GSAGGLRVSG GLKICFQGVK ETEND*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the regulation of the circadian clock. Acts as a repressor of CCA1 by binding to its promoter. No binding to the LHY promoter. {ECO:0000269|PubMed:19286557}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa20g011780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010491463.11e-105PREDICTED: transcription factor TCP21
SwissprotQ9FTA29e-76TCP21_ARATH; Transcription factor TCP21
TrEMBLR0GX404e-84R0GX40_9BRAS; Uncharacterized protein
STRINGXP_010491463.11e-105(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17822685
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.16e-52TCP family protein
Publications ? help Back to Top
  1. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  2. Ng DW,Chen HH,Chen ZJ
    Heterologous protein-DNA interactions lead to biased allelic expression of circadian clock genes in interspecific hybrids.
    Sci Rep, 2017. 7: p. 45087
    [PMID:28345627]
  3. Lee CM, et al.
    Decoys Untangle Complicated Redundancy and Reveal Targets of Circadian Clock F-Box Proteins.
    Plant Physiol., 2018. 177(3): p. 1170-1186
    [PMID:29794020]