PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa20g005610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family NAC
Protein Properties Length: 658aa    MW: 73672.3 Da    PI: 4.154
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa20g005610.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.33e-53101371128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yLk+kv +k++++ ++i+ +diyk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk+tgkd+e+ 
  Csa20g005610.1  10 LAPGFRFHPTDEELVRYYLKRKVCNKPFKF-DAISVTDIYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIR 103
                     579**************************9.99**************95347777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++vg+kktLv++kgrap+ge+t+Wvmheyrl
  Csa20g005610.1 104 N-GSRVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 137
                     9.9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-618160IPR003441NAC domain
PROSITE profilePS5100558.57610160IPR003441NAC domain
PfamPF023657.0E-2812137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MGRDSVTTSL APGFRFHPTD EELVRYYLKR KVCNKPFKFD AISVTDIYKS EPWDLPDKSK  60
LKSRDLEWYF FSMLDKKYSN GSKTNRATEK GYWKTTGKDR EIRNGSRVVG MKKTLVYHKG  120
RAPRGERTNW VMHEYRLSDE DLKRAGVPQE AYVLCRIFQK SGTGPKNGEQ YGAPFLEEEW  180
EEDAMTYVPD QDAFSEGLAV DDDVYVDIDE IDEKPENLVI YDAVPILPNY CHGESSNNVE  240
SGNHSDSGNY IQPGNYVVDS GGYFEQPIET FEEDKKPIIR DGSIQPCSLF PEEHIDCGVQ  300
DENAVNLDSS NNNVFVAADT CYSDVPIDTN YLPDEPFMDP NNSLPLNDGN YVVDSGGYFE  360
QPIETFEEDK KPIIRDGSIQ PCSLFPEEHI DCGVQDENAV NLDSSNNNVF VAADTCYSDV  420
PIDTNYLPDE PFMDPNNSLP LNDGLYLETN DLSIAQQDDF NFEDYLNDFN FDEDGFTLDD  480
PELDALLDQK PAPEELEKEV AEGKEMVEKK DSGEGSSSKQ DADLTDFDSA SKYPFLKKTS  540
HMLGSIPAPS SFASQFKSKD AAIRLHSESS GSVHVTAGMI RISNMTLAAD SSMGWSYDKN  600
GNLNVILSFG VVQRDDELNA TGSKTGTTET RAMLIFMCLW VLVLSVSFKI GTMVSAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-44916616171NO APICAL MERISTEM PROTEIN
1ut4_B6e-44916616171NO APICAL MERISTEM PROTEIN
1ut7_A6e-44916616171NO APICAL MERISTEM PROTEIN
1ut7_B6e-44916616171NO APICAL MERISTEM PROTEIN
3swm_A7e-44916619174NAC domain-containing protein 19
3swm_B7e-44916619174NAC domain-containing protein 19
3swm_C7e-44916619174NAC domain-containing protein 19
3swm_D7e-44916619174NAC domain-containing protein 19
3swp_A7e-44916619174NAC domain-containing protein 19
3swp_B7e-44916619174NAC domain-containing protein 19
3swp_C7e-44916619174NAC domain-containing protein 19
3swp_D7e-44916619174NAC domain-containing protein 19
4dul_A6e-44916616171NAC domain-containing protein 19
4dul_B6e-44916616171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa20g005610.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0996090.0AY099609.1 Arabidopsis thaliana putative protein (At5g04410) mRNA, complete cds.
GenBankAY1288590.0AY128859.1 Arabidopsis thaliana putative protein (At5g04410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010490950.10.0PREDICTED: NAC domain-containing protein 78-like isoform X3
RefseqXP_010490951.10.0PREDICTED: NAC domain-containing protein 78-like isoform X4
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLD7LXI40.0D7LXI4_ARALL; Uncharacterized protein
STRINGXP_010490949.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  6. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]