PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa19g048710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family CPP
Protein Properties Length: 593aa    MW: 63813.6 Da    PI: 8.4468
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa19g048710.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR461e-14126165141
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e
  Csa19g048710.1 126 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVE 165
                     589**************************.********975 PP

2TCR49.86.7e-16212250240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     + kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Csa19g048710.1 212 HYKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 250
                     789**********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.1E-16126166IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.371127251IPR005172CRC domain
PfamPF036387.4E-11128163IPR005172CRC domain
SMARTSM011147.1E-19211252IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12214249IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MGEGEGEGDK LPPKKDEVIT QESMKSARQL DFTHVVHPLH SNQAPVTSAA SASSSIPSPA  60
VTATPPITTS QARPVSTTTV ATPIPPPPQP QGLLHVPIRH PERKPESPKS KPRAVGVGET  120
RDGTPQKKKQ CNCKHSRCLK LYCECFASGT YCDGCNCVNC FNNVEFDTAR REAVQSVLDR  180
NPNAFKPKIA SSPHGGRDSR EEVGEPVMLG KHYKGCHCKK SGCLKKYCEC FQANILCSEN  240
CKCLDCKNFE GSEDRQSLFH GEHSHNVAYL QHVNAAITGA IGSYGFASAP GPKRKKGQEF  300
FLNQGTKDSP THRLGQYNYW YQANTGRTPS SKTDSRAGGP SKVVYRSLLA DIIQPKNVKA  360
LCSVLVAVAG EAAKALTEKR LADQKETSVS SSVQDQGQGN NKGDEVEKAA SGNQAEKSGP  420
EDSSSDGSKG RSLSPDTLAL MCDERDTMLM VATSPNGSVE PTSQLPNGGQ DQFYAEQEKV  480
VLTKFRDCLN QIISCGELKE SNFSSSRMDL DTPAHTAVKI QPVVQQRPVA NGVSQTIKQP  540
SQRTTTTTPT PTTRLTTTTT TTTTPTPTPI PTTTSAQTQL HKTPALSEKK DL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-351182601132Protein lin-54 homolog
5fd3_B2e-351182601132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa19g048710.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935560.0AB493556.1 Arabidopsis thaliana At2g20110 mRNA for hypothetical protein, partial cds, clone: RAAt2g20110.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010489093.10.0PREDICTED: protein tesmin/TSO1-like CXC 6
SwissprotQ9SL700.0TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLA0A1P8B2C50.0A0A1P8B2C5_ARATH; Tesmin/TSO1-like CXC domain-containing protein
STRINGXP_010489093.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.10.0Tesmin/TSO1-like CXC domain-containing protein