PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa19g021980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family SBP
Protein Properties Length: 182aa    MW: 21126.7 Da    PI: 10.1634
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa19g021980.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.91.1e-4163138277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv++C+a+l+eak+y+rrh+vCevh+ka++++v+g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk +
  Csa19g021980.1  63 CQVDRCTANLTEAKQYYRRHRVCEVHAKASAATVTGVRQRFCQQCSRFHELPEFDEAKRSCRRRLAGHNERRRKIS 138
                     *************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.4E-3260124IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.57360137IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-3862141IPR004333Transcription factor, SBP-box
PfamPF031109.2E-3263136IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MEGQRTQRRG YLKDKVTVSN LDEEEMENGT DGEEEDGGVE DKRKRVMERV RVPSTDRLPS  60
RLCQVDRCTA NLTEAKQYYR RHRVCEVHAK ASAATVTGVR QRFCQQCSRF HELPEFDEAK  120
RSCRRRLAGH NERRRKISGD IYGEGSGRRG FSSQLVQTQE RNRIEMKLPM TNSSFKRSQI  180
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-4061136984squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0037140.0BT003714.1 Arabidopsis thaliana At3g15270 mRNA, complete cds.
GenBankAK1186110.0AK118611.1 Arabidopsis thaliana At3g15270 mRNA for squamosa promoter binding protein-like 5, putative, complete cds, clone: RAFL19-86-N19.
GenBankAJ2429600.0AJ242960.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 5, (SPL5 gene).
GenBankAJ0116100.0AJ011610.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010487346.11e-131PREDICTED: squamosa promoter-binding-like protein 5
SwissprotQ9S7581e-109SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLR0G7J61e-121R0G7J6_9BRAS; Uncharacterized protein (Fragment)
STRINGAT3G15270.11e-107(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.11e-106squamosa promoter binding protein-like 5