PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g093530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family TCP
Protein Properties Length: 392aa    MW: 42913.8 Da    PI: 7.0804
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g093530.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP118.29.9e-37361472115
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaak 96 
                     +g+kdrhsk++T++g+RdRRvRlsa++a++f+d+qd+LGfd++sk+++WL+++ak ai++l+++  ++ + ++a +++ ++++++++k   s ++
  Csa17g093530.1  36 TGRKDRHSKVCTAKGPRDRRVRLSAPTAIQFYDVQDRLGFDRPSKAVDWLIKKAKSAIDDLAEL--PPWNPADALRQHAANAKPRKTKTLVSPPP 128
                     79**************************************************************..33322322233333333333333333333 PP

             TCP  97 skksqksaasalnlakesr 115
                     +++++++++++ + +++++
  Csa17g093530.1 129 PQPPPQHHQETEHHHHHHQ 147
                     3333333332222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.1E-3336147IPR005333Transcription factor, TCP
PROSITE profilePS5136934.2723896IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MRHSQQSAFT ASPTENDGGG CGEIVEVQGG HIVRSTGRKD RHSKVCTAKG PRDRRVRLSA  60
PTAIQFYDVQ DRLGFDRPSK AVDWLIKKAK SAIDDLAELP PWNPADALRQ HAANAKPRKT  120
KTLVSPPPPQ PPPQHHQETE HHHHHHQIGE EDNESSFLPA SMDSDSIADT IKSFFPVASS  180
QQSYHHHQPP SRANTQNQDL LRLSLQSFQN GPPFTDQTEP VLFSSQSNHP LGFDSSTASW  240
EQSHQSPEFG KIQRLVTWNN GGAADSPEST GGGGGGGGGY VFASPSPVFS QSQLLSQRGP  300
LQSINNTPMI RAWFDPHHHH HHQSMTTDDL HHHHHHYHVP TGIHQSAIPG IAFASSGEFS  360
GFRIPARFHG EQEEAHGGDN KPSSASSDSR H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A4e-204396154Putative transcription factor PCF6
5zkt_B4e-204396154Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa17g093530.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0080071e-140AC008007.7 Genomic sequence for Arabidopsis thaliana BAC F12M16 from chromosome I, complete sequence.
GenBankAF0721341e-140AF072134.1 Arabidopsis thaliana TCP3 mRNA, complete cds.
GenBankAK1186151e-140AK118615.1 Arabidopsis thaliana mRNA, clone: RAFL19-87-O22.
GenBankAY0996781e-140AY099678.1 Arabidopsis thaliana putative flower development protein cycloidea (At1g53230) mRNA, complete cds.
GenBankBT0002661e-140BT000266.1 Arabidopsis thaliana putative flower development protein cycloidea (At1g53230) mRNA, complete cds.
GenBankCP0026841e-140CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010479875.10.0PREDICTED: transcription factor TCP3-like
SwissprotQ9MAH80.0TCP3_ARATH; Transcription factor TCP3
TrEMBLD7KKF40.0D7KKF4_ARALL; Uncharacterized protein
STRINGXP_010479875.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24082771
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53230.10.0TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 3
Publications ? help Back to Top
  1. Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL
    Active suppression of a leaf meristem orchestrates determinate leaf growth.
    Elife, 2017.
    [PMID:27710768]
  2. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  3. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]
  4. Mazur MJ, et al.
    Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci.
    Front Plant Sci, 2017. 8: p. 2043
    [PMID:29250092]