PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g051600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family G2-like
Protein Properties Length: 364aa    MW: 41181.7 Da    PI: 8.5521
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g051600.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-32221274255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Csa17g051600.1 221 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 274
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15218274IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28219274IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-23221274IPR006447Myb domain, plants
PfamPF002492.3E-7222273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWQRRRS TTDQEDHEEL DLGFWRRALD SRTSTLVSNS  60
SSKPTNHPFQ DLSLSNNSHH HQQHQHHQPH LVPNCNGSNI LTSFQFPTQQ QQQHLQGFLA  120
HDLNTHLRPI RGIPLYHNPP PHHHHRPPPP CFPFDPSSLI PSSSPSPPSL TGNNHSFNTS  180
SVSNSGLITN PNYHNHHHHH QTLNRARFMP RFPAKRSMRA PRMRWTTTLH ARFVHAVELL  240
GGHERATPKS VLELMDVKDL TLAHVKSHLQ MYRTVKTTDK AAASSGQSDV YENGSSGDNN  300
SDDWMFDMNR KSRDSEELTN PLEKGNGLWT NSSGEARLHG KLIDNVAEIM LPSEVRYISF  360
CNI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAB4934910.0AB493491.1 Arabidopsis thaliana At1g32240 mRNA for hypothetical protein, partial cds, clone: RAAt1g32240.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010480826.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6160.0KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0D2ZR210.0A0A0D2ZR21_BRAOL; Uncharacterized protein
STRINGAT1G32240.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-172G2-like family protein