PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g039410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family VOZ
Protein Properties Length: 490aa    MW: 54408.1 Da    PI: 5.8961
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g039410.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ444.11.7e-1362064221217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                     pppsaflgpkcalwdc+rpaqg++w+qdycssfha+la+neg+pg++pv+rp+gi+lkdgllfaalsak+ gk+vgipecegaatakspwna+el
  Csa17g039410.1 206 PPPSAFLGPKCALWDCPRPAQGFDWFQDYCSSFHAALAFNEGPPGMNPVVRPGGIGLKDGLLFAALSAKAGGKDVGIPECEGAATAKSPWNAPEL 300
                     89********************************************************************************************* PP

             VOZ  96 fdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklv 190
                     fdl++le+et+rewlffdkprrafesgnrkqrslpdy+grgwhesrkq+m efgglkrsyymdpqp+++fewhlyeyein++da+alyrlelklv
  Csa17g039410.1 301 FDLTVLESETLREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQIMVEFGGLKRSYYMDPQPLHHFEWHLYEYEINKCDACALYRLELKLV 395
                     *********************************************************************************************** PP

             VOZ 191 dekksakgkvskdsladlqkklgrlta 217
                     d+kk++kgkvs+ds+adlqk++grlta
  Csa17g039410.1 396 DGKKNSKGKVSNDSVADLQKQMGRLTA 422
                     *************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MTGKRTKTNC RSASHKLFKD KAKNRVDDLQ GMLLDLQSAR KESRGTDVSL LEEQVNQMLR  60
EWKSELNEPS PASSLQQGGT LGSFSSDICR LLQLCDEEDD ATSKLAAPKP EPADQNLEAG  120
KAAVFQRGYN FVQGKSEHGF PLADHCKDPP LVVGNNNFVG TANLEYNQFD LQQEFEPNFN  180
GGFNDCPSYG VEGPLHISTF MPTICPPPSA FLGPKCALWD CPRPAQGFDW FQDYCSSFHA  240
ALAFNEGPPG MNPVVRPGGI GLKDGLLFAA LSAKAGGKDV GIPECEGAAT AKSPWNAPEL  300
FDLTVLESET LREWLFFDKP RRAFESGNRK QRSLPDYNGR GWHESRKQIM VEFGGLKRSY  360
YMDPQPLHHF EWHLYEYEIN KCDACALYRL ELKLVDGKKN SKGKVSNDSV ADLQKQMGRL  420
TAEFPPENNN MTTTTTTNNN NKRCIKGRPK VNTKVATVNV QNTVEQAADY GVGEEFNYLV  480
GNLSDYYIA*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa17g039410.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1252560.0AB125256.1 Arabidopsis thaliana AtVOZ1 mRNA for transcription factor AtVOZ1, complete cds.
GenBankAK2270140.0AK227014.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL09-45-I22.
GenBankBT0202610.0BT020261.1 Arabidopsis thaliana At1g28520 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010478228.10.0PREDICTED: transcription factor VOZ1 isoform X3
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLR0GLR40.0R0GLR4_9BRAS; Uncharacterized protein
STRINGXP_010460649.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66672745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]