PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g026440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family Nin-like
Protein Properties Length: 857aa    MW: 95499.4 Da    PI: 5.4577
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g026440.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85e-29566616252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Csa17g026440.1 566 DKTITLDVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 616
                     689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.2555636IPR003035RWP-RK domain
PfamPF020423.3E-25568616IPR003035RWP-RK domain
SuperFamilySSF542778.83E-23747844No hitNo description
PROSITE profilePS5174528.83756839IPR000270PB1 domain
SMARTSM006661.7E-26756839IPR000270PB1 domain
CDDcd064073.12E-43757837No hitNo description
Gene3DG3DSA:3.10.20.2403.7E-21757836No hitNo description
PfamPF005641.1E-19757838IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 857 aa     Download sequence    Send to blast
GVSVKSKLHL SMEDSFLQTE NAVMDSEFMD GLLLDGCWLE TTDGSEFLNV APSTSSVIPF  60
DPSSFMWSPT QDTSAVVSQM YGQDCVERSS LDDFQWNKRW WIGPGGGGGS SVTERLVQAV  120
EHIKDYTTER GSLIQLWVPV NRGGKRVLTT KEQPFSHDPM CQRLANYREI SVNYHFSAEQ  180
DDSKALAGLP GRVFLGKLPE WTPDVRFFKS EEYPRVHHAQ DCDVRGTLAI PVFEQGSKIC  240
LGVIEVVMTT EMVKLRPELE SICKALQAVD LRSTELPIPP SLKGCDLSYK AALPEIRNLL  300
RCACETHKLP LAQTWVSCLQ QNKSGCRHND ENYIHCVSTI DDACYVGDPT VREFHEACSE  360
HHLLKGQGVA GQAFLTNGPC FSSDVSNYKK SEYPLSHHAN MYGLHGAVAI RLRCIHTGSA  420
DFVLEFFLPK DCDDLEEQRK MLNALSTIMA HVPRSLRTVT DKELEEESEV IEREEVVTPK  480
IENTSELQQL HGSSPWSASL EEIQRSNNSS NPQNLGLVFD GGDKPNDGFG LKRGFDYTMD  540
SNVNESSTFS SGGFSMTAEK KRTKADKTIT LDVLRQYFAG SLKDAAKNIG VCPTTLKRIC  600
RQHGIQRWPS RKIKKVGHSL QKIQRVIDSV QGVSGPLPIG SFYANFPNLV SQSQETSQQA  660
KTSPPPPPLP PVQLEKSPVS SYSQSSNSSQ CCSSETQLNS GATTDPASAS VGVSLKKNSS  720
EIELQSSSLD ETILTLSSLE NVPQGTNLLS SQDDDFLRIK VSYGEEKIRF RMRNSRRLTD  780
LLWEIGKRFS IDDMSRYDLK YLDEDNEWVL LTCDEDVEEC VDVCRTTPSH TIKLLLQVSS  840
HHFPERSSAT EYSLWH*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa17g026440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0910150.0AY091015.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010477309.10.0PREDICTED: protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLR0GUM30.0R0GUM3_9BRAS; Uncharacterized protein
STRINGXP_010477309.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein