PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g015580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GeBP
Protein Properties Length: 382aa    MW: 42230 Da    PI: 5.221
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g015580.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573133.85.9e-42157252297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     +fqr+w+e+Dei++LqGl+d+k++tg+sp+dd++++y+ vkks+sf+vsk q++eK+r+LKkK++++v kak+g+epsf+k+hd+ +felsk +W
  Csa17g015580.1 157 YFQRVWTEDDEIAVLQGLMDYKKETGVSPYDDTNGVYQLVKKSVSFDVSKIQFMEKLRSLKKKYENNVGKAKNGEEPSFAKPHDRRTFELSKLVW 251
                     79********************************************************************************************* PP

          DUF573  97 g 97 
                     g
  Csa17g015580.1 252 G 252
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045049.8E-35158252IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MSSKRFDPME DPPSASSSDD DEVDAPLEEG DEIVGNSSSD EEEYDDDDLP SAPPMKNVLF  60
LPATTGKLVS DSESGSGEET ESDSEPKKKK DQFLTNHPTV KHVTETKDSV AKDQDSKKVK  120
TFEKSVGKRS RQTDEGVVSS TKRVKKSGGG EETKKTYFQR VWTEDDEIAV LQGLMDYKKE  180
TGVSPYDDTN GVYQLVKKSV SFDVSKIQFM EKLRSLKKKY ENNVGKAKNG EEPSFAKPHD  240
RRTFELSKLV WGANGMALDS VVKPNGKSKK SSKSKKVESV KQEIDSSLPN GKNSEDVMTT  300
NKGVVEMDSF AKSSLVKSLA RVGVDELAAD KGLSMLASED KKRIEEQWKA LQVREFEFCS  360
QKSGFIHEVV TKIGEAFRSN V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010476078.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLR0I1M21e-149R0I1M2_9BRAS; Uncharacterized protein
STRINGAT1G11510.11e-118(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.16e-88DNA-binding storekeeper protein-related transcriptional regulator