PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g011410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family NF-YC
Protein Properties Length: 211aa    MW: 23373.1 Da    PI: 10.0381
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g011410.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC48.12.6e-151051921299
           NF-YC  12 katdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                      ++d k  ++P+ ri++i+++d+   +i  +a  l+ ka e+fi  ++  ++  + + k++ ++   ++++v++ + ++fl d vp++
  Csa17g011410.1 105 GVEDAKMFRFPMNRIRRIMRSDNSAPQIMQDAVFLVNKATEMFIERFSEEAYESSVQDKKKFIHYKHLSSVVSNDERYEFLADYVPEK 192
                     57899999*****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.12E-19112191IPR009072Histone-fold
PfamPF008089.3E-22113176IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.1E-24114191IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MVSSKKPKEK KAKSDAVNKT GGGRSKRSSG SRTKKASNKV NIVKKEAEIH EISDSSSSDS  60
VEEEAIRSDA PKKSNGAVSK GRNGKRGGGG NPTKTSKNRE EDDGGVEDAK MFRFPMNRIR  120
RIMRSDNSAP QIMQDAVFLV NKATEMFIER FSEEAYESSV QDKKKFIHYK HLSSVVSNDE  180
RYEFLADYVP EKLKADVALE EWEKGMTDAG *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010475580.11e-151PREDICTED: DNA polymerase epsilon subunit 4-like
TrEMBLQ0WP191e-106Q0WP19_ARATH; Putative uncharacterized protein At1g07980
STRINGfgenesh1_pg.C_scaffold_10006501e-103(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.13e-82nuclear factor Y, subunit C10