PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g009710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family LBD
Protein Properties Length: 212aa    MW: 24115.8 Da    PI: 9.7659
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g009710.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260106.91.6e-3324115192
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                     aCa+Ck++r+kC+++C+l+py+pa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g ++++ ++l+  k+
  Csa17g009710.1  24 ACASCKHQRKKCNNECILSPYYPARKTKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSDSLTWEALWRQKDPVLGSYGEYRRICEELKLYKS 115
                     7***********************************************************************************99998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.85823123IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-3024114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MMQRNSNTTN NNNNISNNSS SHQACASCKH QRKKCNNECI LSPYYPARKT KEFQAVHKVF  60
GVSNVQKMVR TVREEDRTKL SDSLTWEALW RQKDPVLGSY GEYRRICEEL KLYKSLVHNQ  120
PLLGWDNNNY QRVYTNNNNN KTGLVMNSSG SGGFSVNNNN GVGGVNGEIV IGGSYTSRDL  180
QSGWENLKHD QRQQCYTVIN SFKQGQHYLP R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-17251011288LOB family transfactor Ramosa2.1
5ly0_B2e-17251011288LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa17g009710.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010475359.11e-157PREDICTED: LOB domain-containing protein 2-like
SwissprotQ9LNB91e-110LBD2_ARATH; LOB domain-containing protein 2
TrEMBLD7KG181e-111D7KG18_ARALL; Uncharacterized protein
STRINGXP_010475359.11e-156(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.15e-90LOB domain-containing protein 2