PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g053490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GeBP
Protein Properties Length: 392aa    MW: 41962.5 Da    PI: 4.8909
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g053490.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573127.74.9e-40157249397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     f+rlw+e+Dei++LqG+idfka+tgksp++d ++ y+f+kk isf+vsk+q+++K+r+L+kK+ +k+ k  +g epsf+k+hdqk++el+k+iWg
  Csa16g053490.1 157 FHRLWTEDDEIAVLQGMIDFKADTGKSPYEDSNGYYDFIKKDISFEVSKNQFMDKLRSLRKKYMGKEVK--NGVEPSFAKPHDQKAYELAKIIWG 249
                     89***************************************************************9988..***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.0E-32157249IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MTKKLNPLED PPSASSSDDD DIETSEAGEP SDDSSSSEDD ESSKAPIKSL ASAAAAASSK  60
STVVAESDSG SETETDSDSE STNPPNSGSG KTISVNLKKK EDPTSSAALA LPAAKSGGTK  120
RPASEAAAAT ASATANKRVK KVTSGGGEEE SVKKPGFHRL WTEDDEIAVL QGMIDFKADT  180
GKSPYEDSNG YYDFIKKDIS FEVSKNQFMD KLRSLRKKYM GKEVKNGVEP SFAKPHDQKA  240
YELAKIIWGP EGIATESNVK SNGVSKKSKA KTKLGSVKQE LVYAGSSPNG KMDEDGDDDD  300
DMDLVVHGGG GSRKSDLFES SSLVRMVAGC GVDEYYVKRQ WSLLPVETKK VVEEKLKLLQ  360
AKELEFVMEK TDFLHEVTSM IVEASKNKKS H*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010473386.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLR0GHD81e-168R0GHD8_9BRAS; Uncharacterized protein
STRINGAT1G61730.11e-160(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.16e-94DNA-binding storekeeper protein-related transcriptional regulator