PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g027000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family TCP
Protein Properties Length: 306aa    MW: 34285.9 Da    PI: 4.6187
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g027000.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP79.11.2e-2483125244
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkd 44 
                     a+kkdrhskihT++g+RdRRvRls+ +a++fFdLqd+LGfdk+
  Csa16g027000.1  83 AVKKDRHSKIHTAQGLRDRRVRLSIGVARQFFDLQDMLGFDKA 125
                     89***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.8E-2284125IPR005333Transcription factor, TCP
PROSITE profilePS5136919.42985143IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MMSSSKNDGS NNGVYPLSFY LSSLPGHQDI IRNPYNQQLT ASPRQMVSSV PKSLIDYMPF  60
NSNDAVNQQG FVLPELSREI KKAVKKDRHS KIHTAQGLRD RRVRLSIGVA RQFFDLQDML  120
GFDKANFGDN RGDVEEEVEE EEDEDGDNSL VYGSSPESCG KKVVCEVKKA DKRKKNNELS  180
NISSKGSRNN LETISDITQS ETLDSFKRSI FSNEGEEMTH FFYKETIGEF GNQESISTKM  240
KINMPTNMDQ SYNQDTGAFM LIDQGSSSNY STIDLPLVDY NYEQNPFVDQ TFCAVTDTSF  300
PGGLP*
Functional Description ? help Back to Top
Source Description
UniProtInvolved in petal morphogenesis. {ECO:0000269|PubMed:17940055}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa16g027000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892001e-105AC189200.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB005J17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019083210.10.0PREDICTED: transcription factor TCP1-like
SwissprotQ9FYG71e-116TCP1_ARATH; Transcription factor TCP1
TrEMBLR0GHY51e-152R0GHY5_9BRAS; Uncharacterized protein
STRINGXP_010415290.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67332744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.11e-112TCP family protein
Publications ? help Back to Top
  1. Mazur MJ, et al.
    Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci.
    Front Plant Sci, 2017. 8: p. 2043
    [PMID:29250092]