PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g016440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family M-type_MADS
Protein Properties Length: 342aa    MW: 39473.1 Da    PI: 7.0652
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g016440.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.93.4e-15951345
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    ien+  r   + +Rr+g+lKK +ELS+LCd+++++iifs++  
  Csa16g016440.1  9 IENDKARARRLKQRREGLLKKVKELSILCDIRALLIIFSPNEA 51
                    99*************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.671149IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-6121IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-16158IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.46E-18388IPR002100Transcription factor, MADS-box
CDDcd002663.27E-26382No hitNo description
PfamPF003193.6E-13950IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-62136IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-63657IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MAKVKLAWIE NDKARARRLK QRREGLLKKV KELSILCDIR ALLIIFSPNE AVPMVWPSVE  60
MARGILDDFF ALPKFVQKQK ETGVKSILEE KMKTVHEQIM KSNEKKEYVV DELMMRLQHG  120
RGIDDLNLSE IHALLSFSKD KIILYRKKLN FMQFSTLRDP PVLPFEVQAE QLKITTNDAF  180
EGSGQDDDKK RKTDEEPRIF NIDTFRENKS YYLIDRWFLD PKPLEHVIYQ QMRNDNPNFV  240
SYFPYQGSGS NGNASLEMEP VSPQVMTFHG LVGSASQPLQ YCNMTNNAIM AMNQPIDLMS  300
RALERQDEGN NINNSEFYMT NNTATTNNDV RQEPPPNGNN R*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11623RRLKQRRE
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa16g016440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010474003.10.0PREDICTED: MADS-box transcription factor 21-like
TrEMBLA0A178VQF21e-131A0A178VQF2_ARATH; AGL48
TrEMBLQ9XEF11e-131Q9XEF1_ARATH; AGAMOUS-like 48
STRINGXP_010474003.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.11e-135AGAMOUS-like 48