PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g085650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family CPP
Protein Properties Length: 586aa    MW: 62608.4 Da    PI: 8.3099
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g085650.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.81.2e-14109147140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ 
  Csa15g085650.1 109 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNL 147
                     589**************************.********96 PP

2TCR49.86.6e-16195233240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     + kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Csa15g085650.1 195 HYKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 233
                     789**********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.8E-17109149IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.342110234IPR005172CRC domain
PfamPF036387.5E-11111146IPR005172CRC domain
SMARTSM011147.1E-19194235IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12197232IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MGEGDKLPPK KDEVITQDSM KSARQLDFTH VVHPPHSNQA PVTSAAASSP IPSPAVTATP  60
PITTSQARPV STTTVLTPIP PPPQPQGLLH VPIRHPAVGV GETRDGTPQK KKQCNCKHSR  120
CLKLYCECFA SGTYCDGCNC VNCFNNLEFD TARREAVQTI LDRNPNAFKP KIANSPHGGR  180
DSREEVGEPV MLGKHYKGCH CKKSGCLKKY CECFQANILC SENCKCLDCK NFEGSEDRQS  240
LFHGEHSHNM AYLQHVNAAI TGAIGSYGFA SAPGPKRKKG QEFFYNQGTK DSPTHRLGQA  300
NTGRTPSLKT DSRAGGPSKV VYRSLLADII QPKNVKALCS VLVAVAGEAA KALTEKRLAD  360
QKETSVSSSV QDQGQGNNKG TEVEIAASGN QADKSGPEDS SSDGSKGRSL SPDTLALMCD  420
ERDTMLMVTA SPNGSVEPTS QLPNGGQDQF YAEQEKVVLT KFRDCLNQII SCGELKESNF  480
SSSRMNLDTP AHTAVKVQPV VQQRPVANGV SQTIKQPSQL TTTTPTPTTT PTPTPTPTPT  540
PTPTPTPTTT PTPTPTPTPT PTTTTTTSAQ TQLHKTPALS EKKDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-361012431132Protein lin-54 homolog
5fd3_B2e-361012431132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa15g085650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935560.0AB493556.1 Arabidopsis thaliana At2g20110 mRNA for hypothetical protein, partial cds, clone: RAAt2g20110.
GenBankAY1637750.0AY163775.1 Arabidopsis thaliana hypothetical protein (T2G17.9) mRNA, partial cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010467935.10.0PREDICTED: protein tesmin/TSO1-like CXC 6
SwissprotQ9SL700.0TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLA0A1P8B2C50.0A0A1P8B2C5_ARATH; Tesmin/TSO1-like CXC domain-containing protein
STRINGXP_010467935.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.10.0Tesmin/TSO1-like CXC domain-containing protein