PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g050010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family M-type_MADS
Protein Properties Length: 337aa    MW: 39039.4 Da    PI: 6.7981
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g050010.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.54e-141151343
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    ien+  r +   kRr+g+lKK +E+ +LCd+++++i+fs++
  Csa15g050010.1 11 IENDNSRVIRSKKRREGLLKKIHEVTILCDVKACIIMFSPE 51
                    99999999999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.0E-21160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.871149IPR002100Transcription factor, MADS-box
CDDcd002665.96E-25285No hitNo description
SuperFamilySSF554551.14E-19395IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-9323IPR002100Transcription factor, MADS-box
PfamPF003194.5E-131151IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MARKKIKLAW IENDNSRVIR SKKRREGLLK KIHEVTILCD VKACIIMFSP EEDYPMVWPS  60
LKQARDLLDD FFALPEIEKK RKETSLESYL KEKTKKVQEQ LMKTHKKNQN YAIDQMMLQL  120
HRGRSIADLD LNEIYALISF SKDKVILHRK RLHFVQHSPL RDPPVPLFER KFEEFETTTN  180
DVFARGRQED ERAWYTNEAR KEININDAIS GNQSCYLIDQ WFPFQGNDIN GLEMEPIGAP  240
VISFHGLVGS VSQPLQHHNT NNNPTMAMSQ PNQCPFDFMN PEFGVKEKGS MVNNGDSQFQ  300
RRSNTIEISN GIRRESPPKE ATDGEDNDDV MPIDMN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKIKLAWIENDNSRVIRSKKRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa15g050010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019096769.10.0PREDICTED: floral homeotic protein PMADS 1-like
TrEMBLV4NQI01e-134V4NQI0_EUTSA; Uncharacterized protein
STRINGBostr.19424s0082.1.p1e-157(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.11e-103AGAMOUS-like 48