PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g040480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family CPP
Protein Properties Length: 674aa    MW: 74314.2 Da    PI: 5.9357
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g040480.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.63.8e-16377415240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Csa15g040480.1 377 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 415
                     689**********************************96 PP

2TCR50.54.2e-16462500139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Csa15g040480.1 462 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNV 500
                     589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19376417IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.507377502IPR005172CRC domain
PfamPF036386.4E-12379414IPR005172CRC domain
SMARTSM011143.7E-17462503IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.5E-11464499IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
DSPVFNYISN LSPIESVKSI STAQTFSSLS FTSPPPVFTS PHVNSYRESR FFRCHNSIDR  60
TKPLEDLNGS VFKEEAVVPV IEDLNKEAPF EDEEEETSVE TSSELPQILK SDSQTPDRSD  120
SPCTDDVTLE APSDNPRGEG GSSSEDVKMG LEKMLDVREA NDTPNCGRLI SDATELLVFR  180
SPNDSEAFRC LVDKISSSER RFCAGVKSTK RPDINKDVPA NGSSNENEPS AVLPNESVFS  240
LNRGGMRRRC LDFEMPGKRK KEIADDQQSV CDNKEAGESS SSCVVPGIGL HLNSVALSAR  300
DSNINVVHDY SISGEIQKSF SGSTTPIQSQ DTVQETSDQA ENEPVEEVPR ALVFPELNSG  360
SLKKKKRVSE QAGEGESCKR CNCKKSKCLK LYCECFAAGV YCIEPCSCID CFNKPIHEET  420
VLATRKQIES RNPLAFAPKV IRSADSIMEA GDDASKTPAS ARHKRGCNCK KSNCLKKYCE  480
CYQGGVGCSI NCRCEGCKNV YGRKEGSLLV IMESKQEEDQ ETYEKRRAKI QHKIEVSREV  540
EQNPSSDQPS TPLPPYRHLV VHQPFLSKNR LPPTQFFIGM GSSSFRKQDS DLTQSHNEKK  600
PIDPVTEDKT EIMPEILLNS PIANIKAISP NSKRVSPPQL GSSESGSNLR RRGNGRKLIL  660
RSIPAFPSLN PNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1638150014121Protein lin-54 homolog
5fd3_B2e-1638150014121Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1246260RRRCLDFEMPGKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00370DAPTransfer from AT3G22780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa15g040480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2040590.0AF204059.1 Arabidopsis thaliana CXC domain protein TSO1 (TSO1) mRNA, complete cds.
GenBankAF2063240.0AF206324.1 Arabidopsis thaliana putative DNA binding protein (tso1) mRNA, tso1-3 allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010488309.10.0PREDICTED: CRC domain-containing protein TSO1 isoform X2
RefseqXP_019096881.10.0PREDICTED: CRC domain-containing protein TSO1 isoform X1
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A178VBV10.0A0A178VBV1_ARATH; TSO1
STRINGXP_010468392.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]