PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g040470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family CPP
Protein Properties Length: 617aa    MW: 67194.7 Da    PI: 7.8383
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g040470.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR513e-16328366240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Csa15g040470.1 328 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 366
                     689**********************************96 PP

2TCR51.32.4e-16413451139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Csa15g040470.1 413 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNA 451
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-19327368IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.223328453IPR005172CRC domain
PfamPF036385.8E-12330365IPR005172CRC domain
SMARTSM011143.7E-17413454IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.4E-12415451IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 617 aa     Download sequence    Send to blast
MDTPEKSITQ IGTPVSKLKS EDSPVFNYIC NLSPIKTLKS IPIAQTLSSL NFTSPPSVFT  60
SPHAVSHKES RFRSQINKDV VASVGEEVKE EALTGNEPSQ NVKNDFSTPK VSNDVRGGGN  120
GSCEDGGMDL LKMCDNVKKK SDTPDWETLI AATTELIYGS PSESEAFSCL MKRRSNSGAR  180
VRGGGGTKST LEEPVSSTVV ANNETESFDA NSILHRGVRR RCLDFEVPGN NQQTLGESSS  240
SCVVPSIGLH LNAIAMSSKD NNVANEYSLS GNIKVGLQSS TSPVLHSQQD AGQAVEEFPI  300
SSALVEINPI SAKKKRRKSE QSGEGEASCK RCNCKKSKCL KLYCECFAAG VYCIEPCSCI  360
DCFNKPIHED VVLATRKQIE SRNPLAFAPK VIRNSDSIIE VGDDTSKTPA SARHKRGCNC  420
KKSNCLKKYC ECYQGGVGCS INCRCEGCKN AFGRKDGSLF EQDEENEVSA KRVTAKTQQN  480
VELFNPVVPP STPIPFRQPL SQLPISSNNR LLPPVEHFHH GASGSSSSGI YNIRKQDMSM  540
VSHSRIEIIS EDIDDDMPEN LLNHSPMTNM KAVVSPNRKR VSLPHLDSSE ETPWRRNGGR  600
KLIHSIPTFP SLTPHH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1633045012120Protein lin-54 homolog
5fd3_B1e-1633045012120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1312316KKKRR
2312317KKKRRK
3313317KKRRK
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00044PBMTransfer from AT3G22760Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa15g040470.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010466568.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLD7L2F20.0D7L2F2_ARALL; Uncharacterized protein
STRINGXP_010466568.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]