PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g014000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family NAC
Protein Properties Length: 499aa    MW: 56277.7 Da    PI: 4.2639
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g014000.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.64.1e-5291361128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +d+yk+ePwdLp k k+k+++ ewyfFs  dkky +g+++nrat+ gyWk+tgkd+e+ 
  Csa15g014000.1   9 LAPGFRFHPTDEELVRYYLKRKICNKPFKF-DAISVTDVYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYGNGSKTNRATEMGYWKTTGKDREIR 102
                     579**************************9.99**************95347777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++vg+kktLv++kgrap+ge+++Wvmheyrl
  Csa15g014000.1 103 N-GSKVVGMKKTLVYHKGRAPRGERSNWVMHEYRL 136
                     9.9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-607160IPR003441NAC domain
PROSITE profilePS5100558.0549160IPR003441NAC domain
PfamPF023651.8E-2711136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MGGGSATSLA PGFRFHPTDE ELVRYYLKRK ICNKPFKFDA ISVTDVYKSE PWDLPDKSKL  60
KSRDLEWYFF SMLDKKYGNG SKTNRATEMG YWKTTGKDRE IRNGSKVVGM KKTLVYHKGR  120
APRGERSNWV MHEYRLVDEE LEKTNVHQQD AYVLCRIFQK SGSGPKNGEQ YGAPFVEEEW  180
EEEDDIITFV PDPDLGCEDH VYVHMDDIDQ KPDNLVVYDA IPLPLNFNHG ESSNNAETNY  240
SDSINYIQPG NYVDSGGYFD KPEESSEKDQ KPIIRDDDLH IDALFHDDEI GCGVQDGHTV  300
NLQSSGNIFV TDSSCYNDFP VESNYLTGGE FQDPNSNVLQ NDGLYLETND LSSTQQDGFN  360
VEDYLTFFDE DDENAQYLTF DPSQLMGDED VFVDQEELFQ EVDKEETTGD KQVVEAKEKD  420
EASCSKQVDA DATEFEPDYK YPFLKKASHM LGAIPAPPAF ASEFPTKAAA IRLNAGQSSG  480
SVHVTAVSFK VSTLVTSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-44816619174NAC domain-containing protein 19
3swm_B1e-44816619174NAC domain-containing protein 19
3swm_C1e-44816619174NAC domain-containing protein 19
3swm_D1e-44816619174NAC domain-containing protein 19
3swp_A1e-44816619174NAC domain-containing protein 19
3swp_B1e-44816619174NAC domain-containing protein 19
3swp_C1e-44816619174NAC domain-containing protein 19
3swp_D1e-44816619174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (Ref.6, PubMed:24323506, PubMed:25219309). Promotes reactive oxygen species (ROS) production during drought-induced leaf senescence. In response to abscisic acid (ABA)-mediated drought stress signals, binds directly to the promoters of RBOHC and RBOHE genes, encoding ROS biosynthetic enzymes, resulting in ROS accumulation and triggering leaf senescence via programmed cell death (PCD). ROS-induced leaf senescence sustains plant survival under drought conditions (PubMed:22313226). Involved in heat stress response. Modulates PCD through a ROS-mediated positive feedback control under heat stress conditions. This may provide an adaptation strategy for plant survival under extreme heat stress conditions (PubMed:25219309). Acts as repressor in preventing anther dehiscence during stamen development by suppressing genes that participate in jasmonic acid (JA) biosynthesis, such as DAD1, AOS, AOC3, OPR3 and 4CLL5/OPCL1 (PubMed:24323506). {ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:24323506, ECO:0000269|PubMed:25219309, ECO:0000269|Ref.6}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa15g014000.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) (PubMed:22313226, PubMed:25219309). Induced by heat shock (PubMed:25219309). Induced by cold, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:25219309}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0510030.0AY051003.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
GenBankAY0793450.0AY079345.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010464726.10.0PREDICTED: NAC domain-containing protein 53-like
SwissprotQ949N00.0NAC53_ARATH; NAC domain-containing protein 53
TrEMBLR0HKM10.0R0HKM1_9BRAS; Uncharacterized protein
STRINGXP_010464726.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.10.0NAC domain containing protein 53
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y
    Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress.
    Plant Cell, 2014. 26(12): p. 4656-79
    [PMID:25549671]
  4. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  5. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]