PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g007300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family M-type_MADS
Protein Properties Length: 283aa    MW: 32329.2 Da    PI: 6.9146
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g007300.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.71.3e-171053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     ien+  r  tf kR++g lKK +ELSvLC++e++ +++s+++ 
  Csa15g007300.1 10 YIENDPMRRATFNKRKKGFLKKIHELSVLCGIEACAVVYSPSNS 53
                    59**************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.96E-24185IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.054152IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-22160IPR002100Transcription factor, MADS-box
CDDcd002663.70E-32285No hitNo description
PRINTSPR004046.4E-11323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-161152IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MTRKRLNLSY IENDPMRRAT FNKRKKGFLK KIHELSVLCG IEACAVVYSP SNSTPEAWPS  60
NVGVKNVVEK FQMLTDMEQE KKMVNHEGFL KQNISKAMGN NKRKMKDNAE RMMKEAMFEL  120
LGGKEDRFKL TNRHREDLCK YIDQYLKELH HHKNKILRQS HVGYGESSEA ATNVMAPTSS  180
GEVNSQFFPT LNVSNSPSQI PEEVNAFPGN NFSAAADQQD YYPVMNPAVG FYDHNANVNH  240
LGHNQYQQED VYRPSVHQDG IDNPSQNQNQ QEEWLVSDDD LS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa15g007300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019092504.10.0PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLS6BIQ21e-119S6BIQ2_TURGL; Agamous-like MADS-box protein AGL45 (Fragment)
STRINGXP_010486064.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.11e-103M-type_MADS family protein