PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g063510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family SBP
Protein Properties Length: 183aa    MW: 20974.5 Da    PI: 10.0299
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g063510.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.21e-4264139277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv++C+adl+eak+yhrrhkvCevh+ka++v++sg++qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++
  Csa14g063510.1  64 CQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHELQEFDEAKRSCRRRLAGHNERRRKSS 139
                     **************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375751.6E-611150IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.107.1E-3458125IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.42861138IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.24E-3863142IPR004333Transcription factor, SBP-box
PfamPF031101.7E-3264137IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MEGRRTQGKG YLKSKSYLVE EEMENDMDGE EEIGRDEEKR KGLMDGLRRS STGSIDRGGS  60
SRLCQVDRCT ADLKEAKQYH RRHKVCEVHA KASSVFLSGV SQRFCQQCSR FHELQEFDEA  120
KRSCRRRLAG HNERRRKSSG ESFGEGSGRR VITGQVIQNQ ERSRVEMTLP MPNSSFKRPQ  180
IR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-4759137484squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0849021e-153AY084902.1 Arabidopsis thaliana clone 12071 mRNA, complete sequence.
GenBankAJ0116321e-153AJ011632.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 4, partial.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010462181.11e-130PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
SwissprotQ9S7A93e-92SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLR0I1J91e-105R0I1J9_9BRAS; Squamosa promoter-binding-like protein
STRINGfgenesh2_kg.1__4389__AT1G53160.21e-104(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.23e-78squamosa promoter binding protein-like 4