PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g048840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family M-type_MADS
Protein Properties Length: 286aa    MW: 32746.9 Da    PI: 6.6026
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g048840.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF61.69.1e-201056248
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                     ien+s r+ tf kR++g  KK +ELSvLC++e++v+i+s+++ + e
  Csa14g048840.1 10 YIENDSMRKATFNKRKKGFVKKIHELSVLCGIEACVVIYSPSNSVPE 56
                    59****************************************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.96E-25185IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-26160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.147161IPR002100Transcription factor, MADS-box
CDDcd002666.89E-35285No hitNo description
PRINTSPR004044.0E-12323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MTRKKLNLSY IENDSMRKAT FNKRKKGFVK KIHELSVLCG IEACVVIYSP SNSVPEVWPS  60
NLGVKNVVEK FEMLTDMEQE KKMVNHEGFL KQNISKAMGN NKRKMKDNAE RMMKEAMFEL  120
LGGKADRFKL TLTNIHREDL CKYIDQYLKE LYHHKNIILR QSHVEYDESS EAATNFMAPT  180
SSVEVNSQFF PTFNVSNSQC FQLSSNEVNT FPGNNLSTVV AQQDYYPVIN PVGVYDHNAN  240
VNHLGHNQYQ QQDGYPTIVP QYGIDNPSQN QGQQEEWLVS DDDLS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa14g048840.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019092504.11e-173PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLS6BIQ21e-113S6BIQ2_TURGL; Agamous-like MADS-box protein AGL45 (Fragment)
STRINGXP_010486064.11e-170(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.11e-103M-type_MADS family protein