PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g041570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family M-type_MADS
Protein Properties Length: 341aa    MW: 38574.6 Da    PI: 5.9154
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g041570.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF33.84.3e-111050343
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    i n+  r+ tf +R++gi KK +E  +LC+++++ +i s+ 
  Csa14g041570.1 10 IANNYLRKQTFKRRKAGIEKKLHEFTTLCGVKACAVICSPY 50
                    889999********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.386148IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-8158IPR002100Transcription factor, MADS-box
CDDcd002662.10E-22179No hitNo description
SuperFamilySSF554555.49E-20292IPR002100Transcription factor, MADS-box
PfamPF003191.0E-111054IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MRSKLKLSLI ANNYLRKQTF KRRKAGIEKK LHEFTTLCGV KACAVICSPY ENPVLWPSAE  60
GVQEVVSKVM ELPVEDQCKY MFNHETYLRR EITKAEKQVE KLRSDNRETQ LRQFMFDCLE  120
GKMNQHPYDA TDLQDLRSYI GSYIKKLDFR MKVLTEENGE SSSSTLLLPS SVAGADSPAV  180
EVTGHPVVAD ASMVTELNGF YGYFPYDGMT MNPIPNQHES LVQHHVPVDS VQHHVPVGSV  240
EYHTPMNFDD QIQHGIYDMN LHQDMSLDPN QYPYQQGSFM NLLLGHPQEM GYDGEHAHIP  300
FVNGNYHQLP TMDFATTGHM PSINTNTIAG VYAPDDINAL *
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa14g041570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010460983.10.0PREDICTED: agamous-like MADS-box protein AGL86
SwissprotQ9C6V31e-100AGL86_ARATH; Agamous-like MADS-box protein AGL86
TrEMBLS6BCF01e-116S6BCF0_CRUWA; Agamous-like MADS-box protein AGL92 (Fragment)
STRINGXP_010460983.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31630.14e-99AGAMOUS-like 86
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]