PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g024800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family bZIP
Protein Properties Length: 473aa    MW: 52534.3 Da    PI: 5.1035
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g024800.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.33e-07158218161
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                     e+e +r rr   NRe+Ar   +R++a +eeL +k++ L+ eN+ L+ e +   ke ++l++
  Csa14g024800.1 158 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLTYENENLRREKDWALKEFQSLET 218
                     78899*****************************************998888888877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001706.9E-7158220IPR004827Basic-leucine zipper domain
SMARTSM003383.2E-9158222IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.036160223IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-6162227No hitNo description
SuperFamilySSF579593.15E-6162217No hitNo description
CDDcd147021.28E-12168214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MELEHISSCC SSSSSGEEAA AADMTEMEAA EALADLAQLA IMREQVFEPA SSWGSKGKRV  60
RKRAKTESPP SGSLLKPPDS ETLPTPDLAE ERLVKEEEDE EEEEEEEDEV QPVVKELTKA  120
PVKTEMNGET PKPNLASTVS CSRSNGCGRS RQNLSEAERE ERRIRRILAN RESARQTIRR  180
RQAMCEELSK KAADLTYENE NLRREKDWAL KEFQSLETMN KHLKEQVAKS VKPDTKEPEE  240
PTKPSKVEMS TSSTPIYFYN QNPYQLFCWP HVTQSSNPVV SPLEFATSGG VSAKTMIPQE  300
HENPADDNGQ KTHFYVVPCP WFLPSPDSNG VSFGIQDTHR GTLSNGHHID DSSARPLEVT  360
KTPWAHLSSS IKEEDSGSPE TRPLYDLNES ATEVLSEGGE GFPVTQQAFS LKHEDTSETT  420
NGVTPMPPGH HVLISLPGKN QGSLTAAEAR KRRKELTRLK NLHGRQCRMQ VG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1449454RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa14g024800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0998750.0AY099875.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
GenBankBT0003190.0BT000319.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010459621.10.0PREDICTED: uncharacterized protein LOC104740647
TrEMBLR0II410.0R0II41_9BRAS; Uncharacterized protein
STRINGXP_010459621.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.10.0bZIP family protein