PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g014260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GeBP
Protein Properties Length: 383aa    MW: 42118.9 Da    PI: 5.2059
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g014260.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573134.82.9e-42153248297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     +fqr+w+e+Dei++LqGl+d+k++tg+sp+dd++++y+ vkks+sf+vsk q++eK+r+LKkK++++v kak+g+epsf+k+hd+k+fe+sk +W
  Csa14g014260.1 153 YFQRVWTEDDEIAVLQGLMDYKNDTGVSPYDDTNGVYQLVKKSVSFDVSKIQFMEKLRSLKKKYENNVGKAKNGEEPSFAKPHDRKTFEFSKLVW 247
                     79********************************************************************************************* PP

          DUF573  97 g 97 
                     g
  Csa14g014260.1 248 G 248
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.8E-34154248IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MSSKRFNPLE DPPSASSSDD DEVDASLEEG DEIVGNSSSD EEYDDDDGLP SAPPMKNVLF  60
LPAATGKLVS DSESVSGEET ESDSEPRKKK DQFLTVKHVM TETKDSVVKD QDSKKVKTSE  120
KSVGKRSRQT DEGGVSSTKR VKKSGGEETK KTYFQRVWTE DDEIAVLQGL MDYKNDTGVS  180
PYDDTNGVYQ LVKKSVSFDV SKIQFMEKLR SLKKKYENNV GKAKNGEEPS FAKPHDRKTF  240
EFSKLVWGAN GMALDSVVKP NGKSKKSSKS KKVESVKQVI DSSLPNGKNS EDEVTNKGGV  300
SLLGVAEMDV FAKSSLVKSL ARVGVDELAA DQGLSLLASE DKKRIEEQWR ALQVREFEFH  360
SQKSGFIHEV VTKIGEAFRS NV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010458551.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLR0I1M21e-158R0I1M2_9BRAS; Uncharacterized protein
STRINGAT1G11510.11e-115(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.16e-99DNA-binding storekeeper protein-related transcriptional regulator