PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g009420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family NF-YC
Protein Properties Length: 210aa    MW: 23356.2 Da    PI: 9.9375
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g009420.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC48.12.5e-151041911299
           NF-YC  12 katdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                      ++d k  ++P+ ri++i+++d+   +i  +a  l+ ka e+fi  ++  ++  + + k++ ++   ++++v++ + ++fl d vp++
  Csa14g009420.1 104 GVEDAKMFRFPMNRIRRIMRSDNSAPQIMQDAVFLVNKATEMFIERFSEEAYESSVQDKKKFIHYKHLSSVVSNDERYEFLADYVPEK 191
                     57899999*****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.26E-19111190IPR009072Histone-fold
PfamPF008089.2E-22112175IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.1E-24113190IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MVSSKKPKEK KAKSDAVNKT GGRSTRSSGS ITKKASNKVN IVKKEPEIHE ISDSSSSDSV  60
EEEAIRSDAP KKKSNGAVSK GRNGKRGGAI PTKTSKNREE DDGGVEDAKM FRFPMNRIRR  120
IMRSDNSAPQ IMQDAVFLVN KATEMFIERF SEEAYESSVQ DKKKFIHYKH LSSVVSNDER  180
YEFLADYVPE KLKADVALEE WEKGMTDAG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0252660.0BT025266.1 Arabidopsis thaliana At1g07980 mRNA, complete cds.
GenBankAY0868150.0AY086815.1 Arabidopsis thaliana clone 28026 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010458017.11e-151PREDICTED: uncharacterized protein LOC104739381
TrEMBLQ0WP191e-107Q0WP19_ARATH; Putative uncharacterized protein At1g07980
STRINGfgenesh1_pg.C_scaffold_10006501e-104(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.15e-86nuclear factor Y, subunit C10