PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g007690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family LBD
Protein Properties Length: 212aa    MW: 24014.7 Da    PI: 9.6481
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g007690.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260106.62e-3325116192
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                     aCa+Ck++r+kC+++C+l+py+pa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g ++++ ++l+  k+
  Csa14g007690.1  25 ACASCKHQRKKCNNECILSPYYPARKTKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSDSLTWEALWRQKDPVLGSYGEYRRVCEELKLYKS 116
                     7**********************************************************************************999998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.78224124IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3025115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MMQRNSNTTT NNNNNISNNS SSHQACASCK HQRKKCNNEC ILSPYYPARK TKEFQAVHKV  60
FGVSNVQKMV RTVREEDRTK LSDSLTWEAL WRQKDPVLGS YGEYRRVCEE LKLYKSLVHN  120
QPLLGWDNNH QRVYTNNNNN KTGLVMNSSG SVGFCVNNNG VGGVNGEIVN GGSYTSRDLQ  180
GGWENLKHDQ RQQCYAAVIN GFKQGQYYLP R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-17261021288LOB family transfactor Ramosa2.1
5ly0_B3e-17261021288LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa14g007690.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738650.0AB473865.1 Arabidopsis thaliana ASL32 mRNA for ASYMMETRIC LEAVES2-like 32 protein, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF9P140.0AC025290.3 Sequence of BAC F9P14 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010457753.11e-157PREDICTED: LOB domain-containing protein 2-like
SwissprotQ9LNB91e-111LBD2_ARATH; LOB domain-containing protein 2
TrEMBLV4MVQ11e-110V4MVQ1_EUTSA; Uncharacterized protein
STRINGXP_010457753.11e-157(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.18e-97LOB domain-containing protein 2