PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa13g034650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family M-type_MADS
Protein Properties Length: 118aa    MW: 13233 Da    PI: 8.2223
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa13g034650.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF33.17.2e-112341547
                    HHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
          SRF-TF 15 kRrngilKKAeELSvLCdaevaviifsstgkly 47
                    kR++gi KK +EL +LC+++++ +i+s+ + + 
  Csa13g034650.1  2 KRKKGITKKLHELKTLCGVQACGVIYSPYQSVP 34
                    9**************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500669.068128IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-11245IPR002100Transcription factor, MADS-box
PfamPF003197.4E-10231IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MKRKKGITKK LHELKTLCGV QACGVIYSPY QSVPEVWPSK EDLNDNQYLN HENSFNDMML  60
AQNVGYAGGH ARIPFIDHYN YHQQPTVDLA ITNHMPSITS STTSITSVYA SYINKNL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa13g034650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010493922.19e-32PREDICTED: agamous-like MADS-box protein AGL36
TrEMBLR0H4005e-27R0H400_9BRAS; Uncharacterized protein
STRINGXP_010456732.15e-48(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.11e-18AGAMOUS-like 38